spacer

EBI Dbfetch

ID   FN552709; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FN552709;
XX
DT   24-SEP-2009 (Rel. 102, Created)
DT   24-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*0604
DE   allele, exons 2-3, clone LUMC-DQ63
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (17-SEP-2009) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "New alleles found during routine SBT HLA typing";
RL   Unpublished.
XX
DR   MD5; 3354201d31a2948f30538bce3cd453f8.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="LUMC-DQ63"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0604"
FT                   /product="MHC class II antigen"
FT                   /function="immune response"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:38"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CBF35736.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVQWFQNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0604"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0604"
FT                   /number=3
XX
SQ   Sequence 652 BP; 125 A; 154 C; 173 G; 100 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccagtgg       480
     tttcagaatg atcaggagga gacagccggc gttgtgtcca ccccccttat taggaatggt       540
     gactggactt tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer