spacer

EBI Dbfetch

ID   FN552548; SV 1; linear; genomic DNA; STD; HUM; 1008 BP.
XX
AC   FN552548;
XX
DT   23-SEP-2009 (Rel. 102, Created)
DT   23-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1008
RA   Witter K.;
RT   ;
RL   Submitted (21-SEP-2009) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A new HLA-DPB1 allele, DPB1*new was revealed in a family high resolution
RT   HLA typed via sequence based typing";
RL   Unpublished.
XX
DR   MD5; 76ff87bb0c62c4b04b68f61b8299ebbf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1008
FT                   /organism="Homo sapiens"
FT                   /isolate="sample 197119"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<32..295,574..>855)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C8ZLH7"
FT                   /db_xref="IMGT/HLA:DPB1*16:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C8ZLH7"
FT                   /protein_id="CBF04503.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            32..295
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   intron          296..573
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   gap             322..421
FT                   /estimated_length=unknown
FT   exon            574..855
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
XX
SQ   Sequence 1008 BP; 219 A; 256 C; 253 G; 180 T; 100 other;
     gcctccgctc atgtccgccc cctccccgca gagaattacc ttttccaggg acggcaggaa        60
     tgctacgcgt ttaatgggac acagcgcttc ctggagagat acatctacaa ccgggaggag       120
     ttcgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       180
     gatgaggagt actggaacag ccagaaggac atcctggagg aggagcgggc agtgccggac       240
     aggatgtgca gacacaacta cgagctggac gaggccgtga ccctgcagcg ccgaggtgag       300
     tgagggcttt gggccggcgg tnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nagccaatat tgcaccactg cattccagac ttggcaacag agcgacactc cacctcaaca       480
     aaaagaaaga aagagcgaga ttacgtctca aaaaaggaag gaaggaagga caatctcaaa       540
     tgctatttca ttattttcct tccccactcg tagtccagcc taaggtgaac gtttccccct       600
     ccaagaaggg gcccctgcag caccacaacc tgcttgtctg ccacgtgaca gatttctacc       660
     caggcagcat tcaagtccga tggttcctga atggacagga ggaaacagct ggggtcgtgt       720
     ccaccaacct gatccgtaat ggagactgga ccttccagat cctggtgatg ctggaaatga       780
     ccccccagca gggagacgtc tacatctgcc aagtggagca caccagcctg gacagtcctg       840
     tcaccgtgga gtggagtgag tctctgatga ccgtctagac cccacctctg aagagcaggg       900
     gactctctgg ctctggggtc cactcatctt atcttctgca tctataccct ggggccatgt       960
     ccaaacccca tctttcttct ataccagctc ctgagcatag tttgaagc                   1008
//


spacer
spacer