spacer

EBI Dbfetch

ID   FN551180; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN551180;
XX
DT   18-SEP-2009 (Rel. 102, Created)
DT   18-SEP-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*03XX
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wallis-Jones S.;
RT   ;
RL   Submitted (16-SEP-2009) to the INSDC.
RL   Wallis-Jones S., Anthony Nolan Trust, Routine Sequencing, NW3 2QG, London,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Wallis-Jones S.;
RT   "A novel HLA-DRB1 allele most similar to DRB1*0340 with three base
RT   changes,";
RL   Unpublished.
XX
DR   MD5; 8a1656c0857c1a0ed495bc4f53c11635.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation molecule"
FT                   /db_xref="GOA:C8ZLD6"
FT                   /db_xref="IMGT/HLA:DRB1*03:49"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C8ZLD6"
FT                   /protein_id="CBE70345.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03XX"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer