spacer

EBI Dbfetch

ID   FN545816; SV 1; circular; genomic DNA; STD; PRO; 4191339 BP.
XX
AC   FN545816;
XX
PR   Project:PRJNA38039;
XX
DT   01-OCT-2009 (Rel. 102, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 4)
XX
DE   Clostridium difficile R20291 complete genome
XX
KW   complete genome.
XX
OS   Peptoclostridium difficile R20291
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Peptostreptococcaceae;
OC   Peptoclostridium.
XX
RN   [1]
RP   1-4191339
RA   He M.;
RT   ;
RL   Submitted (25-AUG-2009) to the INSDC.
RL   He M., Sulston Building, Wellcome Trust Sanger Institute, Wellcome Trust
RL   Genome Campus, Hinxton, Cambridgeshire CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1186/gb-2009-10-9-r102.
RX   PUBMED; 19781061.
RA   Stabler R.A., He M., Dawson L., Martin M., Valiente E., Corton C.,
RA   Lawley T.D., Sebaihia M., Quail M.A., Rose G., Gerding D.N., Gibert M.,
RA   Popoff M.R., Parkhill J., Dougan G., Wren B.W.;
RT   "Comparative genome and phenotypic analysis of Clostridium difficile 027
RT   strains provides insight into the evolution of a hypervirulent bacterium";
RL   Genome Biol. 10(9):R102-R102(2009).
XX
RN   [3]
RA   He M., Sebaihia M., Lawley T.D., Stabler R.A., Dawson L.F., Martin M.J.,
RA   Holt K.E., Seth-Smith H.M., Quail M.A., Rance R., Brooks K., Churcher C.,
RA   Harris D., Bentley S.D., Burrows C., Clark L., Corton C., Murray V.,
RA   Rose G., Thurston S., van Tonder A., Walker D., Wren B.W., Dougan G.,
RA   Parkhill J.;
RT   "Evolutionary dynamics of Clostridium difficile over short and long time
RT   scales";
RL   Proc. Natl. Acad. Sci. U.S.A. 0:0-0(2010).
XX
DR   MD5; 666ef8bcd95af7262aebb3b3872ed4a9.
DR   EnsemblGenomes-Gn; CDR20291_0183.
DR   EnsemblGenomes-Gn; CDR20291_0197.
DR   EnsemblGenomes-Gn; CDR20291_0337.
DR   EnsemblGenomes-Gn; CDR20291_0499.
DR   EnsemblGenomes-Gn; CDR20291_0514.
DR   EnsemblGenomes-Gn; CDR20291_0529.
DR   EnsemblGenomes-Gn; CDR20291_0595.
DR   EnsemblGenomes-Gn; CDR20291_0641.
DR   EnsemblGenomes-Gn; CDR20291_0667.
DR   EnsemblGenomes-Gn; CDR20291_0888.
DR   EnsemblGenomes-Gn; CDR20291_0901.
DR   EnsemblGenomes-Gn; CDR20291_1076.
DR   EnsemblGenomes-Gn; CDR20291_1338.
DR   EnsemblGenomes-Gn; CDR20291_1468.
DR   EnsemblGenomes-Gn; CDR20291_1576.
DR   EnsemblGenomes-Gn; CDR20291_1656.
DR   EnsemblGenomes-Gn; CDR20291_1739.
DR   EnsemblGenomes-Gn; CDR20291_1740.
DR   EnsemblGenomes-Gn; CDR20291_1758.
DR   EnsemblGenomes-Gn; CDR20291_1785.
DR   EnsemblGenomes-Gn; CDR20291_1809.
DR   EnsemblGenomes-Gn; CDR20291_1822.
DR   EnsemblGenomes-Gn; CDR20291_1825.
DR   EnsemblGenomes-Gn; CDR20291_2159.
DR   EnsemblGenomes-Gn; CDR20291_2192.
DR   EnsemblGenomes-Gn; CDR20291_2249.
DR   EnsemblGenomes-Gn; CDR20291_2275.
DR   EnsemblGenomes-Gn; CDR20291_2368.
DR   EnsemblGenomes-Gn; CDR20291_2414.
DR   EnsemblGenomes-Gn; CDR20291_2555.
DR   EnsemblGenomes-Gn; CDR20291_2808.
DR   EnsemblGenomes-Gn; CDR20291_2833.
DR   EnsemblGenomes-Gn; CDR20291_2844.
DR   EnsemblGenomes-Gn; CDR20291_2949.
DR   EnsemblGenomes-Gn; CDR20291_3202.
DR   EnsemblGenomes-Gn; EBG00000018521.
DR   EnsemblGenomes-Gn; EBG00000018522.
DR   EnsemblGenomes-Gn; EBG00000018523.
DR   EnsemblGenomes-Gn; EBG00000018524.
DR   EnsemblGenomes-Gn; EBG00000018525.
DR   EnsemblGenomes-Gn; EBG00000018526.
DR   EnsemblGenomes-Gn; EBG00000018527.
DR   EnsemblGenomes-Gn; EBG00000018528.
DR   EnsemblGenomes-Gn; EBG00000018529.
DR   EnsemblGenomes-Gn; EBG00000018530.
DR   EnsemblGenomes-Gn; EBG00000018531.
DR   EnsemblGenomes-Gn; EBG00000018532.
DR   EnsemblGenomes-Gn; EBG00000018533.
DR   EnsemblGenomes-Gn; EBG00000018534.
DR   EnsemblGenomes-Gn; EBG00000018535.
DR   EnsemblGenomes-Gn; EBG00000018536.
DR   EnsemblGenomes-Gn; EBG00000018537.
DR   EnsemblGenomes-Gn; EBG00000018538.
DR   EnsemblGenomes-Gn; EBG00000018539.
DR   EnsemblGenomes-Gn; EBG00000018540.
DR   EnsemblGenomes-Gn; EBG00000018541.
DR   EnsemblGenomes-Gn; EBG00000018542.
DR   EnsemblGenomes-Gn; EBG00000018543.
DR   EnsemblGenomes-Gn; EBG00000018544.
DR   EnsemblGenomes-Gn; EBG00000018545.
DR   EnsemblGenomes-Gn; EBG00000018546.
DR   EnsemblGenomes-Gn; EBG00000018547.
DR   EnsemblGenomes-Tr; CDR20291_0183.
DR   EnsemblGenomes-Tr; CDR20291_0197.
DR   EnsemblGenomes-Tr; CDR20291_0337.
DR   EnsemblGenomes-Tr; CDR20291_0499.
DR   EnsemblGenomes-Tr; CDR20291_0514.
DR   EnsemblGenomes-Tr; CDR20291_0529.
DR   EnsemblGenomes-Tr; CDR20291_0595.
DR   EnsemblGenomes-Tr; CDR20291_0641.
DR   EnsemblGenomes-Tr; CDR20291_0667.
DR   EnsemblGenomes-Tr; CDR20291_0888.
DR   EnsemblGenomes-Tr; CDR20291_0901.
DR   EnsemblGenomes-Tr; CDR20291_1076.
DR   EnsemblGenomes-Tr; CDR20291_1338.
DR   EnsemblGenomes-Tr; CDR20291_1468.
DR   EnsemblGenomes-Tr; CDR20291_1576.
DR   EnsemblGenomes-Tr; CDR20291_1656.
DR   EnsemblGenomes-Tr; CDR20291_1739.
DR   EnsemblGenomes-Tr; CDR20291_1740.
DR   EnsemblGenomes-Tr; CDR20291_1758.
DR   EnsemblGenomes-Tr; CDR20291_1785.
DR   EnsemblGenomes-Tr; CDR20291_1809.
DR   EnsemblGenomes-Tr; CDR20291_1822.
DR   EnsemblGenomes-Tr; CDR20291_1825.
DR   EnsemblGenomes-Tr; CDR20291_2159.
DR   EnsemblGenomes-Tr; CDR20291_2192.
DR   EnsemblGenomes-Tr; CDR20291_2249.
DR   EnsemblGenomes-Tr; CDR20291_2275.
DR   EnsemblGenomes-Tr; CDR20291_2368.
DR   EnsemblGenomes-Tr; CDR20291_2414.
DR   EnsemblGenomes-Tr; CDR20291_2555.
DR   EnsemblGenomes-Tr; CDR20291_2808.
DR   EnsemblGenomes-Tr; CDR20291_2833.
DR   EnsemblGenomes-Tr; CDR20291_2844.
DR   EnsemblGenomes-Tr; CDR20291_2949.
DR   EnsemblGenomes-Tr; CDR20291_3202.
DR   EnsemblGenomes-Tr; EBG00000018521.
DR   EnsemblGenomes-Tr; EBG00000018522.
DR   EnsemblGenomes-Tr; EBG00000018523.
DR   EnsemblGenomes-Tr; EBG00000018524.
DR   EnsemblGenomes-Tr; EBG00000018525.
DR   EnsemblGenomes-Tr; EBG00000018526.
DR   EnsemblGenomes-Tr; EBG00000018527.
DR   EnsemblGenomes-Tr; EBG00000018528.
DR   EnsemblGenomes-Tr; EBG00000018529.
DR   EnsemblGenomes-Tr; EBG00000018530.
DR   EnsemblGenomes-Tr; EBG00000018531.
DR   EnsemblGenomes-Tr; EBG00000018532.
DR   EnsemblGenomes-Tr; EBG00000018533.
DR   EnsemblGenomes-Tr; EBG00000018534.
DR   EnsemblGenomes-Tr; EBG00000018535.
DR   EnsemblGenomes-Tr; EBG00000018536.
DR   EnsemblGenomes-Tr; EBG00000018537.
DR   EnsemblGenomes-Tr; EBG00000018538.
DR   EnsemblGenomes-Tr; EBG00000018539.
DR   EnsemblGenomes-Tr; EBG00000018540.
DR   EnsemblGenomes-Tr; EBG00000018541.
DR   EnsemblGenomes-Tr; EBG00000018542.
DR   EnsemblGenomes-Tr; EBG00000018543.
DR   EnsemblGenomes-Tr; EBG00000018544.
DR   EnsemblGenomes-Tr; EBG00000018545.
DR   EnsemblGenomes-Tr; EBG00000018546.
DR   EnsemblGenomes-Tr; EBG00000018547.
DR   EuropePMC; PMC2768977; 19781061.
DR   EuropePMC; PMC2820977; 20023081.
DR   EuropePMC; PMC2867753; 20368420.
DR   EuropePMC; PMC2924371; 20808849.
DR   EuropePMC; PMC3122728; 21508155.
DR   EuropePMC; PMC3224701; 20565959.
DR   EuropePMC; PMC3298294; 20678312.
DR   EuropePMC; PMC3416593; 22706062.
DR   EuropePMC; PMC3421540; 22692737.
DR   EuropePMC; PMC3566075; 23405251.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01327; CRISPR-DR14.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; FN545816.
DR   SILVA-SSU; FN545816.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4191339
FT                   /organism="Peptoclostridium difficile R20291"
FT                   /strain="R20291"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:645463"
FT   CDS             9450..9857
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="CDR20291_3551"
FT                   /product="anti-sigma-B factor (serine-protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_3551"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01461"
FT                   /db_xref="GOA:C9YHF8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHF8"
FT                   /protein_id="CBE01461.1"
FT                   /translation="MACETIKMEITTNPDYVSIIRLTASGIANKMGFPIDDIEDIKVAV
FT                   SEACTNAIKHSKDDVFNIVFNILDNAINIEIQDNGKGYDVSSISTPDLENPKESGLGLF
FT                   IIKTLMDDVDIESEHNQGTKIKMTKYLGVDI"
FT   CDS             9857..10630
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="CDR20291_3552"
FT                   /product="RNA polymerase sigma-B factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_3552"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01463"
FT                   /db_xref="GOA:C9YHF9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHF9"
FT                   /protein_id="CBE01463.1"
FT                   /translation="MKNVANATHYLNMDTKELFNLYNKNKNVDIRNILIERHLYLARLL
FT                   AKKYINKGVDFEDIYQVASLALIYAIDRYDVEKGFEFSSFATPTIVGEIKKYFRDKVWT
FT                   LRVPRRIQELSKKISDAKIKLEQENKKHPKVKDIADYIGVSEEDVLEAMEASYGYQPMS
FT                   LDSSSNDDSEDKDITLIDKIGKEEGNFGSIEYEDFINKFIETLNELEVKIFKDRFFFDK
FT                   TQSSIAKELGISQMTVSRLEKKVVEKLKKEYEKNL"
FT   rRNA            10716..12345
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            12598..15548
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            15610..15726
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS             15853..16362
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0001"
FT                   /product="putative small-molecule-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01465"
FT                   /db_xref="GOA:C9YHG0"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG0"
FT                   /protein_id="CBE01465.1"
FT                   /translation="MNSDERRSKLIDILKESKCPVKGGMLAEILNVSRQVIVQDIALIR
FT                   ARGFEIIATPQGYIIYNQPYFTKQIKCKNHRNSKEIYDELKIIVDLGGIVKDVIVNHPT
FT                   YGQITAELNIHSKMDIDNFMKKVETNEFKQLSVLTECSHIHTIETLKEETIEVITKELE
FT                   DRGILS"
FT   CDS             16374..17255
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0002"
FT                   /product="putative mechanosensitive ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01466"
FT                   /db_xref="GOA:C9YHG1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG1"
FT                   /protein_id="CBE01466.1"
FT                   /translation="MNFLSLAKAASTNSNITKRTLENMLNNFSDNIPNIIYAIIVFVIG
FT                   IYISKIVRKMVSRFLIKYGMSKGVNNFIVYGIYISMLSIISLISLGVIGIQTTSVVAVL
FT                   GAAGFSIGLAFKEILSNLGSGMIILFFKPFNIGDYIQGSGVEGTVSDIQIFSTVLKTPD
FT                   NKTIIIPNFQLTSNNIINYTHQNKRRIDFSYNISYDSDIDVVKSILNEIFINEKRILDD
FT                   PKPIIGLNSIGNNTMQIVARPWVKTDDYWDVYFDVMEKVKNKFDENNIKVPFVPSSLLF
FT                   NNMSNSNTMDKR"
FT   CDS             17713..18984
FT                   /transl_table=11
FT                   /gene="serS1"
FT                   /locus_tag="CDR20291_0003"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01468"
FT                   /db_xref="GOA:C9YHG2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG2"
FT                   /protein_id="CBE01468.1"
FT                   /translation="MLDIKRIRENLDDIKKAMERRGEREFDLDAVVELDNKRREILQEV
FT                   EVMKNELNVNSKKIPQLIKEGKDVTEEKTRLKELSDKIKGIDEKVKEVEAKMEYTLMRI
FT                   PNVPHPEVPQGETDEDNVQIRTWGEPTKFDFEYKAHWDIGTGLGILDFERAGKITGSRF
FT                   TLYRGLGARLERSLMNFFLNTHTAKHGYTEVLPPFMANRNSFIGTGQLPKFEEDMFKIE
FT                   GLEYFLIPTAEVPVTNIHANEILDVAELPIKYCAYTPCFRSEAGSAGRDTRGLVRQHQF
FT                   NKVELVKFVKPEDSYNELESLTHDAETMLQMLGLPYRVVKICTGDLGFTAAFKYDLEVW
FT                   MPSYNRYVEISSCSNFEDFQARRAGIRFKRDKKSKAEYVHTLNGSGLAIGRCLAAILEN
FT                   YQQADGSVVVPEELRPYMGVDVIK"
FT   CDS             19304..19759
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0004"
FT                   /product="putative cytosine/adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01470"
FT                   /db_xref="GOA:C9YHG3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG3"
FT                   /protein_id="CBE01470.1"
FT                   /translation="MESSFYMKEALKEAYKAYNKKETPIGAIIVKDNQIIARAHNLTET
FT                   LKDSTAHAEILAIKQASEKLGGWRLTDCDLYVTMEPCIMCSGAIVNSRIKKLIIGTRHV
FT                   KNSYIEKQHEFKLDYFNNNNVKVAFDVLQEECSIILQEFFKALRKRD"
FT   CDS             20230..21867
FT                   /transl_table=11
FT                   /gene="dnaH"
FT                   /locus_tag="CDR20291_0005"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01472"
FT                   /db_xref="GOA:C9YHG4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG4"
FT                   /protein_id="CBE01472.1"
FT                   /translation="MHKALYRAYRPQKFEDVIGQDHIIKTLKNQIYSDNIGHAYLFCGT
FT                   RGTGKTSTAKIFSRAVNCLNKINEEPCNECEICESVLKDNTMDVVEIDAASNNSVDDIR
FT                   ELRESVKYSPANAKYKVYIIDEVHMLSQGAFNALLKTLEEPPSYVIFILATTEPHKIPA
FT                   TILSRCQRYDFKRVTVKDMTLRMKKICEDEGIDIDDKALNLIARNSQGALRDALSILDQ
FT                   CMSFGESKIDYKDVVELMGSVNIEQLFELSQCIVEQDTKKSLEILNEFVLWGKDIRNLI
FT                   NDLIDHFRNLMVCKVSSELDEIISLPEETIEQLKIQSKNIDINDLIRILNILSITQDDI
FT                   KSSSNPRVLVEITIMKIAQPMFDESKEALIKRVENLEKMIELGNFKSEKIGNNKEKEYE
FT                   VDREIDVKQENVVYEDVKNEDVILIESSWKNILKQIKKDKKMPIYALLSEVKSFNVYSN
FT                   MLYVIFDDKFDFAKTRLSSQDTINYLEKTIRDVLNRSFNVKIVLTSEVKDINLEVKEKK
FT                   DIGEEILKNIVSEEILEIKYSIDENESK"
FT   CDS             21926..22276
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01473"
FT                   /db_xref="GOA:C9YHG5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG5"
FT                   /protein_id="CBE01473.1"
FT                   /translation="MAKKGFGGGMMPGGGNMNNLLKQAQKMQENMQKAQQELESKEVEA
FT                   SVGGGAVTVKVNGKKEVIDITIKPEVVDPDDIEMLQDLVLSAVNQALRNIDDIQASQMS
FT                   KVTGGMNIPGLF"
FT   CDS             22289..22888
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="CDR20291_0007"
FT                   /product="recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01475"
FT                   /db_xref="GOA:C9YHG6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG6"
FT                   /protein_id="CBE01475.1"
FT                   /translation="MQVYTGPITRLIEEFSKLPGVGRKTAQRLAFHIINMNTNDVEALS
FT                   KAIIDAKREIRYCSICCNITDTDPCSMCSNKSRDSSVICVVEDPRDVAAMERTREFKGQ
FT                   YHVLNGVISPMDGIGPDMLKIKELIQRLGNQEVKEIIMATNPTIEGEATAMYIARLVKP
FT                   MGIKVTRIAHGLPVGGDLEYADEVTISKALEGRREI"
FT   CDS             complement(23321..24526)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0008"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01477"
FT                   /db_xref="GOA:C9YHG7"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG7"
FT                   /protein_id="CBE01477.1"
FT                   /translation="MSKKVLIMSASTGGGHNRAALAIKEELTSKTLDGEPIECEIIDSL
FT                   KLVNNTMDKIISRGYEKSAIYTPKAYGSVYRLSETNLLSKNEFKDNLLITFMAKKFKKL
FT                   IRSEKPDLIIGTHPFPMIALSTLKKNFNLHNNESNAYTEHFYKHYTNTINVPPLISVLT
FT                   DYTTHSTWIQNEIDYYIVGHEYVKELLVFDGVGPSKIRTFGIPVEKSFLSHRDKDIVLS
FT                   ELNLSPDKLTVLLMGGSFGAGNIKETLDELLDTDRDFQILVITGKNESLKEKIEKKLMS
FT                   RYHDKNVCVLGYTDKMNDILASIDVLVSKPGGLTTTEALLKDVPMIVPYYIPGQEEENL
FT                   DFLSNCGAALRTTKKYNLSILLKVLIDDPSRLEMLKRNVKSIRKSNSAQNIANLILNII
FT                   SG"
FT   rRNA            24945..26723
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            26820..29770
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            29899..30015
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS             33930..34343
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01479"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG8"
FT                   /protein_id="CBE01479.1"
FT                   /translation="MYIVIGNEIVDSEELKIIIDENSKFKVEKDLSKSTKREDVIAYQL
FT                   SIDLNYLDSLINEQCNLSSLSDEEKFDEYMTLSDELALDLEELMPKYTIINARAYKLDE
FT                   VDGIVKIILAVAYADLGHLKLSDVVKRLSRQVD"
FT   CDS             34652..38083
FT                   /transl_table=11
FT                   /gene="pyc"
FT                   /locus_tag="CDR20291_0010"
FT                   /product="pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01480"
FT                   /db_xref="GOA:C9YHG9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHG9"
FT                   /protein_id="CBE01480.1"
FT                   /translation="MLKKFNKILVANRGEIAIRIFRACSELGIKSVGIYSKEDKYGLFR
FT                   TKADESYLIGEGKGPIDAYLDMDGIIDLAKRKKVDAIHPGYGFLAENAEFARKCEENGI
FT                   TFIGPSSKVMNMMGDKINSKKIAKEVNVQTIPGVEKAIRSTEEAKEVANKIGYPVMIKA
FT                   SNGGGGRGMRIVHREEDLELEYETACSESRKAFGEDIIFIEKYIADPKHIEVQILGDNY
FT                   GNIVHLYERDCSVQRRHQKIIEYAPAFSLDDKVRKEICEDAVKLSKHVGYSNAGTLEFL
FT                   VDANGGHYFIEMNTRVQVEHTVTEMVTGIDIVQSQILIAQGYSLDSEEINIKSQDDVEI
FT                   RGYSIQCRITTEDPKNKFMPDTGKIQVYRTGSGFGIRLDGGNGFTGANISPHYDSLLVK
FT                   TISWDRTFQGAINKTIRSIKELRVRGVKTNVGFLVNVLNNPIFSNGKCSTKFIDENPDL
FT                   FEITESKDRGTKLLQFIGDVIVNDNACKEKPLFDALHDPRMDKDGSKSEGSKILFDKLG
FT                   KSAYIEKIKNDKKLLLTDTTMRDAHQSLLATRIRTYDLLKAAKPTEKYQKDLFSLEMWG
FT                   GATYDVAYRFLKESPWRRLQKLREEIPSIMFQMLLRASNGVGYKNYPDNVIEEFTKESA
FT                   RQGIDVFRIFDSLNWVENMKPSINTALETGKIVEATMCYTGDILDKTKTKYNLEYYIKM
FT                   AQELESLGADIIAIKDMSGLLKPYSAYTLVKELKKNVKAPIHLHTHDTSGNGVATCLMA
FT                   SEAGVDIIDAALESMAGLTSQPSLNAIVEALKNTERDTGIDLFGYDELGKYYKDLRKVY
FT                   NKFESDLTNSCAEIYNFEIPGGQYTNLKPQADSLGLVNRFDEVKEKYKEANEVVGDIIK
FT                   VTPSSKVVGDLAIFMTKNKLDKDNIIEEGKNLSFPDSVVDYCKGMIGQPEGGIPKDLQE
FT                   VVLKGEEAITVRPGSLLPAEDFDEIAKYLNEKYDINANIRNVISYALYPKVYEDYIKHL
FT                   QHYNDISKLESDVFFYGLNKNEECEVEIEEGKVLTIRLVEIGEVKENGFRTIGFELNGM
FT                   VREVEIKDKNFSGKINNVEKADMNDPLQIGASIPGKVIKIMVKEEDEVKANQPLIVIEA
FT                   MKMETIIVAKTDGVIKSIKVKEDDMVEDKQLLMIMK"
FT   CDS             38325..40253
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0011"
FT                   /product="putative translation elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01482"
FT                   /db_xref="GOA:C9YHH0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH0"
FT                   /protein_id="CBE01482.1"
FT                   /translation="MKVYDSKMLRNVAVLGHSGCGKTNLIETIAYTANTNKIPKLTDKV
FT                   NMTYSMGLIPIEYNDYKFNLLDTPGYFDFSGDVVSSLRASDAAIIVIDATAPIQVGTEK
FT                   SLELTESIPKIMFINKIDNEKARYKDAIAMLREKYNNKIVPMISPIYKDKNFVKLHNVF
FT                   ENIDDLEGEFKEQAMSVKEALMELIAETDDQILDKYFNGEELTTEEIQKGIIIGIQRGD
FT                   IIPVICGSTINNIGTKEILDTISSYLEPIFTEESKPFRGLVFKTMVDPFVGKMSYIKIT
FT                   EGVLSKDKDVFNINKNVKEKIANIYTLRNSELVEIEKAKAGDIVVITKVNSLKTGDTIS
FT                   ADKDAEALEKIDFPKPQIYYAVTPKNKGDEEKVASVLNKLVEEDPTLHWYRNTETKQAL
FT                   LGGQGELHIKTIKNKMKDKFGVDVELNDLKVPYRETIKGTADVQGKHKKQSGGHGQYGD
FT                   VKIRFERCESDFEFTEEIFGGSVPKQYIPAVEKGLKDSMQKGILAGYPVTNIKATLYDG
FT                   SYHDVDSSEMAFKMAASAAFKKGMEEAHPILLEPIMKLKITVPEEYMGDVMGDINKRRG
FT                   KIFGMEPDDKGKQIIFAEAPQAETFKYAIDLRAMTQGRGYFEMELERYGEVPSQFAEKI
FT                   IGLATAK"
FT   CDS             40706..41170
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="CDR20291_0012"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01484"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH1"
FT                   /protein_id="CBE01484.1"
FT                   /translation="MATMTDIIEKFIKDLMEEDNSIQIQRNELANLFSCAPSQINYVLT
FT                   TRFTIDRGYYIESKKGGGGYVQIEKIRKSKDGHIRELLNEKIGSQISYKKAKELLEGLK
FT                   ESDLINERELKLILYAIDDKSLCMPIYELKEKVRSNILKNIIIGLFSIEE"
FT   CDS             41177..41671
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0013"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01485"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH2"
FT                   /protein_id="CBE01485.1"
FT                   /translation="MLCQKCNKNKASVYYNKIVNGEKTEMYLCSECAKENTEMNFNLDM
FT                   PFSMMDIFSNLGFQPKKELEEKLVCPKCNTTYSEFKNNGRFGCSECYNAFSSQVNPMLQ
FT                   NIHGHIEHTGKAPKKSFYKISVENEIKELKEDLDRAIKNEEYELAAQFRDKIKYLKGSI
FT                   D"
FT   CDS             41687..42712
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0014"
FT                   /product="putative ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01487"
FT                   /db_xref="GOA:C9YHH3"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH3"
FT                   /protein_id="CBE01487.1"
FT                   /translation="MKENIVMKSRVRLARNLNNYPFPNKLDKECAMEIIEKVKNAFINS
FT                   NLEQKEEFDFYKIEDLDQSKKMLMVEEHIISPDLAENDKSAVIVKKDKTISIMINEEDH
FT                   IRIQTICDDLNLEYAYSVANEIDDLLESSLEYAFNTKLGYLTSCPTNTGTGMRASVMMH
FT                   LPALSQLGYMDELYKISSQIGIAIRGIYGERTEALGNIYQISNQLTLGRTESNIIENVS
FT                   GLTKDAISKEIKAREILQKKLGIKLEDKIFRSIGTLENSRVMSSAEAMSHLSNIKMGIE
FT                   MNYIDKLDLRAIEQLMIGIQPAHQSIMYKSDDVENRDINRATYIRETLEKLRGGMNCEL
FT                   Q"
FT   CDS             42897..45146
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="CDR20291_0015"
FT                   /product="ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01489"
FT                   /db_xref="GOA:C9YHH4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH4"
FT                   /protein_id="CBE01489.1"
FT                   /translation="MEGKGEEISEDIVLSPRSKQILELSGMFANKLKTNYIGTEHILLA
FT                   IIQEGEGIANKILNYAGVNDRTLAQLTIDMMGISDKNQYKAENSYTGNQNQAESKVLDK
FT                   YGRNLTLYAKQNKIDPVIGREKEIQRVIQILSRRTKNNPVLIGDPGVGKTAIAEGLATN
FT                   IALGNVPETLKNKTLYSLEMGSLLAGAKYRGEFEERIKEVVDEVVKNGNIILFIDEMHT
FT                   IIGAGSTGEGSIDASNILKPALARGEIQVIGATTIDEYRKHVEKDSALERRFQPVMVDE
FT                   PTKEDSIKILEGLRDKYEAHHKVKITDDAIKAAVELSTRYISDRYLPDKAIDLIDEAAS
FT                   KVRLKENTPPSEIKKLELEIENIDKEKEEAVRCQDFEKAAKIRDEQGLLKKQLEDVRER
FT                   WNKSSKHSDLVDGEVIAEVVGLWTGIPVNKILEEEADRLLRLEEILHNRVIGQEQAVKS
FT                   ISKAIRRSRAGLKDPNRPIGSFLFLGPTGVGKTELSKALAEVQFGDENQIIRIDMSEYM
FT                   EKHAVSRMIGSPPGYVGHDEGGQLTEKVRRNPYSVILFDEIEKAHPDVFNILLQILDDG
FT                   RLTDSKGRTVDFKNTIVIMTSNVGASTIGRQKTLGFSIAKGDEEEKSQYEKMKENIMGE
FT                   LKQRFRPEFLNRIDDIIVFHSLNENHISKIVLLMAAKLQERLKEMDIKLEMSDEAVKLI
FT                   SKSGFDLEYGARPLKRALQKELEDELSEAILKGNVKKGSNVVAKVKDEKIVFETK"
FT   CDS             45326..46699
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="CDR20291_0016"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01490"
FT                   /db_xref="GOA:C9YHH5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH5"
FT                   /protein_id="CBE01490.1"
FT                   /translation="MAKIKTKYVCQSCGYETAKWLGKCPECTKWNTFVEEIDQKSTKKE
FT                   VFIIDKSSSKPVSINSIESKEEERFTTDINELDRVLGGGIVKGSLVLVGGDPGIGKSTL
FT                   LIQVSSNVANLGKTVLYITGEESESQIKMRAKRLGINSENLYIFAENNLSIIESYLESV
FT                   NPELIILDSIQTVFSPEISSAPGTVSQIKEGTSKFMKISKKMGISTFIVGHVTKEGSLA
FT                   GPKLLEHMVDTVLYFEGERYNTYRLVRAVKNRFGSTNELGVFEMRDLGLVELDNPSKIL
FT                   ISEKPKDVAGSVIISTVEGTRPMLLELQALVSPTSFGIPKRTSTGVDYNRVGMLLAVLE
FT                   KRVGLQIQNQDVYINIVGGIKINEPSIDLGIAISVASSFRNIPIDENIAVTGEVGLTGE
FT                   VRAVSFIEKRIAECKKLGFKKIVVPRSNYDVVKETKGIEIWPVDNLRQAINIVLGRNQ"
FT   CDS             46702..47772
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0017"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01492"
FT                   /db_xref="GOA:C9YHH6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH6"
FT                   /protein_id="CBE01492.1"
FT                   /translation="MENFLDNKNMLYALKMISPGTPLRLGLNNVLRAKTGGLIVIATNE
FT                   DVMKIVDGGFAINAEYSPSYLYELAKMDGAIVLSGDVKKILFANAQLIPDYFIETSETG
FT                   TRHRTAERVAKQTGAIVIGISQRRNVITVYRGNEKYVVEDISKIFTKANQAIQTLEKYK
FT                   TVLDQAVTNLNALEFNDLVTIYDVALVMQKMEMVMRVTSIIEKYVIELGDEGTLVSMQL
FT                   EELMGTTRIDQKLIFKDYNKENTEIKELMKKVKNLNSEELIELVNMAKLLGYSGFSESM
FT                   DMPIKTRGYRILSKIHRLPTAIIENLVNYFENFQQILDASIEELDEVEGIGEIRATYIK
FT                   NGLIKMKQLVLLDRHI"
FT   CDS             47861..48955
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0018"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01494"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH7"
FT                   /protein_id="CBE01494.1"
FT                   /translation="MIRKVTRILFILLGFTIGITTYLTLMKDFEILTFGKETYGYIAAV
FT                   VAGIIIAILGYLIEPWVVNKVKEIAKIVDKELSKYPQTDILLGSMGLIVGFVIAYLLSG
FT                   LVNRIPIVGGILSLLLYLFLGYLGMKVALKSKNDLFNIGKLGRLANPIKDKDKDKENKK
FT                   EVKAIPPKVLDTSVIIDGRIADICKTGFIEGKLIIPAFVLEELRHIADSSDDLKRVRGR
FT                   RGLDILNIIQKELNIEVEISERDFDDIAEVDSKLLKLAQVLNGKVVTNDYNLNKVAQFQ
FT                   GVEVLNINELANAIKPVAIPGEDMVVQVVKEGKEAQQGVAYLDDGTMIVVDGGRKYMNE
FT                   TIKVLVTSVLQTPAGRMIFAKPKN"
FT   CDS             49084..51261
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0019"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01496"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH8"
FT                   /protein_id="CBE01496.1"
FT                   /translation="MRKKIISFLATFIIILTSASQYSFADDMSTRGKVIFIDMNRTSMS
FT                   NMLRIKSLREELDNRGYIGLMNIRGDKGSDDRRSYASMGAGGRANVANEEDINFESSSK
FT                   DRNIVFESATGKSAKGINNLTINKSINENLNFGEYGSVLGSLGQSLSENGLKASVLGNS
FT                   DIIENGQLIKNRNLCLTAMDEYGRIPNGNVDTINKKDLSMPYGISTDYDKLIVETKEAY
FT                   KNNDVVFVELGDTYRLDLYKPNLNEKTYESVKDNIEKNIDVYLKNIFSMVEENDTVYIA
FT                   SAFPSDLDYKNKRRLSPIIKLNGEGKGILSSSTTRREGIVTNLDVGVEILDNFNIKNQN
FT                   MVGRKYELINRDDNKEFLMDEYQKIVSISSIRSTILNGFVSIVFLSWIVAMIAILFRKH
FT                   ISKNYKETTFFILKELLKIGIVMPLSFMITPIMNFKTPLAISLGIIIITLTIYLISKVL
FT                   IKNDLKNMLFFTGLTIVIMVIDAGFGSYLMKSNVMSYDCIIGARYYGVGNEYQGVAIGS
FT                   AIFTFAILLTYKNIPKWSIIVFSLVILITSASPIMGANVGSAISECVAFLLFILLIYNV
FT                   KIDFKKIVLLGIAVLFVLGVFVAIDMILGSNSHLGMFVKEIYFNGPGEIIQTFSRKIEM
FT                   NLKLAQTSAWVNILLTGIGVILVLMINQIRYFKQLMDEYPIVFKGFIASIAGCLVTLLV
FT                   NDSGIVSSATAFIYVIVPMITLSINLTALKE"
FT   CDS             complement(51447..52292)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0020"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01498"
FT                   /db_xref="GOA:C9YHH9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHH9"
FT                   /protein_id="CBE01498.1"
FT                   /translation="MNRNNFSHEIIEPIDNLDVNFKLFDDSGSYVANHWHNSLEIIYIT
FT                   SGDLQINMEGYTYNLKANECMFINSGIIHSTRCTYQDTSILLQVPLSFLNKYIPDFKNC
FT                   YFDFKVNANDNNYKKNSGKVKLILENMREIKLSSPPAANLLFTSLLFELLFELYTNFKI
FT                   SVGNKNMKKTVLDLSKFEPVLEYTKINYKMPISINKIAKVAHLQPEYFCRKFKQYMGQT
FT                   YLEYLNDVRISHIYKDLINTNDTLCSILEAHGFTNTKLFYRIFKEKFKCTPKHIRKKST
FT                   "
FT   CDS             52509..53675
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0021"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01499"
FT                   /db_xref="GOA:C9YHI0"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI0"
FT                   /protein_id="CBE01499.1"
FT                   /translation="MYIKGVNLGGWLVLEKWMTSSLFEGTEAEDEYYLPRQLSREAYES
FT                   RIKTHRSEYITERDFATIKSMGFNSVRIPVPYFIFGDCEPFIGCVKELDKAFAWADKYG
FT                   LSILIDLHTVPGSQNGFDNGGISGICSWSQNPEYVAFTLNVLERLAKRYGMRHELYGIQ
FT                   ILNEPITERMWNIMNVPNRFKAVDKEMARGSKPNSLEFLRDFYIKAYKVMRPYMREENV
FT                   IVFHDAFELKAWKDFMREEEFKNIVLDTHQYLMLAESDGCEQSIDSYLKYIRENYAKDI
FT                   LQMQKYFPVICGEWSLFNSYACGIDTNGGQSPLNGIESNIDKLSKDDKRELYRKIAKAQ
FT                   LDAWRNGSGHYYWNYKLLLDTVNEEGWIGWDSWDLGKCVAQEWYPIEY"
FT   CDS             53697..55343
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0022"
FT                   /product="putative beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01501"
FT                   /db_xref="GOA:C9YHI1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI1"
FT                   /protein_id="CBE01501.1"
FT                   /translation="MIKNPILPGFNPDPCICRKGDDYYLVVSSFEWFPGIPVYHSKDLK
FT                   NWELYTHILTDETKIDLKKLPSSKGIWAPCLTYCEEEDLFYIVYGIMNSMNARYFDVDN
FT                   YLITSKDIKGEWSEPVYIHSSGFDASILHDDDGKKWIASLDWETREGYEKPGVICLVEY
FT                   CTKKKEIVGYPKRIWSGGTDRGCIEAPHITKRGDYYYIMCAEGGTGYGHSVTMGRAKNI
FT                   WRPYEKDSMNPIVTSIPGDFYERHDPDHLKPKYYNPESKLQKSGHGSYIETTSGEVYLV
FT                   HLTSRPFVPELRCTLGRETAIQKMKWTKDNWLRMEDESNLAKEYVSESKLEEHLVSSIP
FT                   SFDDFDSNVLGLQYYAPRISPLSFADVKSRPGYVRIRGQESRTSLNKVSILARKLTSVY
FT                   ARITTKMEFYPEVHQHSAGLIMYYDNMNYINLRKYYSETLGQSALSIIHLENGEKTEFL
FT                   NTRIPIKDIPIYLRLYIQGRKSYFEWSYDEKNYQRIGKVFDTTKFSDEYCKYGEFTGTF
FT                   IGLTCADRVKHKHYADFDFFEYIADESKDVD"
FT   CDS             55440..56813
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0023"
FT                   /product="putative xylose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01503"
FT                   /db_xref="GOA:C9YHI2"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI2"
FT                   /protein_id="CBE01503.1"
FT                   /translation="MNTEVNVKATTIRYEKISFFERISYGCGDLGCNIIYSAMSAFLLF
FT                   YYTNYADVSAAAVGSIMLVSRILDGFSDLTMGIIVDRTKSKYGKARPWILRMAIPFAIA
FT                   AVLLFSVPSNLGITSKLIYIFITYNLVSTVIYTAINVPYATLNSLITQNQYERGVLSIF
FT                   RMILATCGTLLINGLTLPLVEYFGNNLSAWTKTFFVFGIASIMVFFITFTGTKERVKAV
FT                   KQDRNEVIPFKIGIKSLFRNKYWIQITLCLVCIFIVFAINGGSSVYYAKFILGDEKLFG
FT                   PINMVSNISQIIAMFMVAPFIKKFGKRNVLIVGSIILISSNVMFIIVGQNYIGVIFASA
FT                   IKGIGSAGIASTMFAIVSDTIEYGEWKTGYRTEGLINSASSFGFKVGNGLGSAILGAVL
FT                   SIGGYVGTSATQSDLAIVSIKVCFIYLPIFITILQIIIMFFYKLDKEYSTILNELNTK"
FT   CDS             57258..58211
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0024"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01504"
FT                   /db_xref="GOA:C9YHI3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI3"
FT                   /protein_id="CBE01504.1"
FT                   /translation="MKKIGDLRLMMKCCSLYYEDNLNQQEIANQLGISRPTISRILKEA
FT                   FEQGIVKIQIVDVLKNDYQKIERSLERKYKLKEVIVVDDKQDALTQKQELARAVSEYLT
FT                   RVVKENDIIGVSIGTTLKEIPRYVEKSNCKNVTFIPLLGGIGDNEIDIHANQIAVSLAR
FT                   AFGGDFKLLHAPAVMSDLSTKEKLCKDEKIKEVLDLIDKTTIAIVGIGNPMSLNSTIMA
FT                   SGYMNEADIEDLKKYNSIGAICLQAFDKEGKTSILEFNQRVLGVKLEDLKKIKRTIGVA
FT                   SGDEKIEAIKASLKAKFINSLAINHSLALKLLEDCD"
FT   CDS             58243..59211
FT                   /transl_table=11
FT                   /gene="acoA"
FT                   /locus_tag="CDR20291_0025"
FT                   /product="acetoin:2,6-dichlorophenolindophenol
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01506"
FT                   /db_xref="GOA:C9YHI4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI4"
FT                   /protein_id="CBE01506.1"
FT                   /translation="MYMSISKETLLEMYKRMNQARKFEEKVSWFFARGMVHGTTHLSVG
FT                   QEASSVAAVMALEKGDLVSLTHRGHSQFIGMGIDLNKMMAELMGKETGFCKGKGGSMHI
FT                   ADIESGNLGANGVVGGGLTIAPGAALTQQYKKTGKIVLCSFGDGASNEGTFHEGINLSS
FT                   IWKLPIIFYCENNLYGMSTSIKRHMNIESIATRAASYGIEGISIDGYNPIEVYETVQKA
FT                   AEKCRRGEGPVLIESRTYRWLGHSKSDANVYRTKEEIESWKAKDPIEFLKNYLIENNLS
FT                   NEDELDKIQEFAKQSIEDAVEFAQNSPNPKIESLLEDVYAD"
FT   CDS             59236..60222
FT                   /transl_table=11
FT                   /gene="acoB"
FT                   /locus_tag="CDR20291_0026"
FT                   /product="acetoin:2,6-dichlorophenolindophenol
FT                   oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01508"
FT                   /db_xref="GOA:C9YHI5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI5"
FT                   /protein_id="CBE01508.1"
FT                   /translation="MSTRELTYAQAIKEAMSEEMRRDENVIFMGEDIGIYGGAFGVSVG
FT                   MIDEFGPERVRDTPISEAAIAGAAAGAAATGLRPIMEVMFMDFVTISMDAIVNQAAKMR
FT                   YMFGGKAQVPMVVRCPGGSGTGSAEQHSQSLEAWFCHVPGVKVVAPSTPADAKGLLKAA
FT                   IRDNNPVIFVENKLLYRKKGFVPEDDYVIEIGKADIKREGTDVTVITYGRMLQSVEEAA
FT                   ETLSKENINVEIIDLRTLYPLDKETIVKSVCKTGRVLICHEAAKTGGLGGEISALITES
FT                   ESFDYLDAPVKRICGKDVPIPYNPELEKAVVPRVDEIEEAIKSLIVR"
FT   CDS             60235..61281
FT                   /transl_table=11
FT                   /gene="acoC"
FT                   /locus_tag="CDR20291_0027"
FT                   /product="E2 component of acetoin dehydrogenase enzyme
FT                   system (dihydrolipoamide acetyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01510"
FT                   /db_xref="GOA:C9YHI6"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI6"
FT                   /protein_id="CBE01510.1"
FT                   /translation="MVANKIKATPAARSQARKDNIKLDRLIGSGENGRIHLVDVLNYLK
FT                   DNKANTTPLARRIAEDLNIDLETIVGTGYSGKIRKCDVEKLTAKETIVSNNTSKYSEKK
FT                   ELKIENENSSMFNTVEGIFEKPNPMRATVAKRMSESYFSAPVFTFNIEVDATELKVLRA
FT                   KLIDTVKESTGVKLTMTDLIVMAVSKILPNHQALNSAWTDEGIFRYKDVNIAIAVGLDE
FT                   GLYVPVVKNANKKSLKEIAKESKELAEKVKTGKLMPADQEGNTFTISNVGMYGITTFTP
FT                   IINMPSSAILGVGATQDKFVPVNGEAKIKPIMNLSLTSDHRVIDGTVAAKFLKDLKELL
FT                   ENPLSMLV"
FT   CDS             61448..63178
FT                   /transl_table=11
FT                   /gene="acoL"
FT                   /locus_tag="CDR20291_0028"
FT                   /product="E3 component of acetoin dehydrogenase enzyme
FT                   system (dihydrolipoyl dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01512"
FT                   /db_xref="GOA:C9YHI7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI7"
FT                   /protein_id="CBE01512.1"
FT                   /translation="MSVEVIMPKAGVAMEEGTIVSWLKQEGEEVKIGEPILEITTDKVN
FT                   MEIESEGEGTLAVIIHKEEGEVLPVFTVIGVIAEKGENQEEVKAKYLSGNVSKEDIVEE
FT                   NQNIEVKEEKINKKECNHDYDVVVIGGGPGGYLSALKAALLGGRVALVEENILGGTCLN
FT                   RGCIPTKTYIKTAEILEEIDQLSKRGVKVTVDKEQDIKKAIKYKNRVVKKLTAGVGGLL
FT                   KSRDVDVFNLKASVKEEHKVILSDGKVLDTENIIIATGSKVRILPIKGIESNLIITSTE
FT                   ALDLETVPEELVIIGGGVIGCEFAEIFNSRGSKVTIVEMEDRVIPRMDKELSESLKYSL
FT                   SKKGINVLTKKKVSEFKEEGNNILVCIEGEVPIKADLCLYAIGREANLSGIEDLDIKID
FT                   KGSIVVNSKMETSIPSIYAVGDVTGGVMLAHAAFKMGEVAASNALGVNKEVDLGALPSC
FT                   VYTIPEVASVGITEEDARKKYNVKVGKFNFAGNGRALASGQEQGYVKVVADAKYGEILG
FT                   IHMFGCGVAELINHAASFKALEIPTDEASELIFGHPCTSEALMEALADVNGECLHLPKK
FT                   "
FT   CDS             63596..66544
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0029"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01513"
FT                   /db_xref="GOA:C9YHI8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI8"
FT                   /protein_id="CBE01513.1"
FT                   /translation="MRQRIKNLIENEDKKNPLTDEAISSRLNIRREDVTFLRNELKIED
FT                   SRQRRKVVLIKAIKDILKEEKTINKNDITRRLNSIGFTVSRFTVIQYLKEIQDSGDLKL
FT                   DKESDDKKEEIINNRENKDIAFDKLIGSSGSLSTIIKLAKAAILYPPHGLHTIIMGPTG
FT                   VGKSELAECMYKFAVESSRFPKNAPFIVFNAADYSENPQLLLSQLFGHVKGAFTGADEN
FT                   KEGLVSKADGGILFIDEIHRLPHEGQEILFQLIDKGMVRKLGETRLTHKIDVMIISATS
FT                   EPIDSHLLNTFKRRIPVTIEIPELVARPLNERFDIINNFFLIEAQRMGANIHIKSDVLK
FT                   ALMLYDCIGNVGQLRSDIQVACARGLLNQLTNKLKEVNISISDVPGYVKQGLIKIRNCR
FT                   GKIENYVDGDLIIDSNLQGEIEKKNEDIYTFPDEIYKLTERRHIDLLEQGLDFDVINRI
FT                   IGGELESCIQKYIKQVKKVSISNNLPDISPIVGKYIVELTYEVIKIASQYLSSLEPNLH
FT                   LCLAVHLKAAFERLKEGKVISNAHLKEIIGNYPLEYSVAEKVAQYLKERYNINLPKEEI
FT                   GIIAIYFKMSSRRDMSEQKKIGVLLMAHGRVASSVCEVTNKLLGINHARYLDMPFEKKP
FT                   EEMIEEATTIIKDIDEGRGVIILVDMGSLSYFGDIISGKTGINIRTISRFDTLLSIEVI
FT                   RRAVLPDLTIDEIVDEVKGIEPQVKEKVSKCNNTKVDFRKPIILTLCITGLGGACKIKK
FT                   ILEENIKSITEKVDIEPIGMIEYPSLDLEIKQISNDKNVIAIVGTIDPQIANIPFFSLV
FT                   DINDKAKLNQINNLIDTNQIGETNKKYELSDLIHKEDIFVDLQVKSKEEVLKYMSKKLR
FT                   EKGYVTKNFYKKVVERDNLFPTELSDEIAIPHTDGIDVIRPAISIAILKKPIVWSKSKV
FT                   KIILLLAVDQKCFNPLSTLLSFIETDEFKKIKNIKDRDFIREMILDGVNENN"
FT   CDS             66522..66986
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0030"
FT                   /product="PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01515"
FT                   /db_xref="GOA:C9YHI9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHI9"
FT                   /protein_id="CBE01515.1"
FT                   /translation="MESMKIISSNLIFKNIEVSNNEDALKFLGQRLFDEQYVKESYIQA
FT                   VVAREKKYATGLPTEIYGVAIPHTDIVHVNEPGIAIGILNKPVKFIMMGTDDTEIDVKV
FT                   VFMLAVKEPQEQLQLLEKLMTIFQDKNILNNIVDLSEESVSDLLNSKLKN"
FT   CDS             67099..67401
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0031"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01517"
FT                   /db_xref="GOA:C9YHJ0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ0"
FT                   /protein_id="CBE01517.1"
FT                   /translation="MGVTNVTKKILVACGTGVCTSTIAINKLKKALQDIGKLDMVNITQ
FT                   CKVVEVASKAPDYDLIICTTQVSSSIKTPVINGLPFLTGVGMDKLINDVLEELEL"
FT   CDS             67463..68827
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0032"
FT                   /product="PTS system, IIc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01519"
FT                   /db_xref="GOA:C9YHJ1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ1"
FT                   /protein_id="CBE01519.1"
FT                   /translation="MEGLYMEILNFIVGLGAQVMMPIIICIFGLILGTKLGKSLRAGLT
FT                   VGVGFIGLNTIIALLTDNLGPATQQMVKNLGLSLSIIDVGWPAASAIAFASTVGALIIP
FT                   IGLVVNIVMLITNTTQTVDVDIWDYWHFAFTGALVAGATQSVMWGVFAAVANMVIVLVM
FT                   ADLTAPGIEEYLGMPGISLPHGFTQAFVPIAIVVNKLLDLIPGINKIEINADTLQKKFG
FT                   LFGEPLIMGSVIGVIIGIAAKYDIKGILQLGVTMGAVLILIPKMAALLMEGLLPVSEAA
FT                   QEFIEKRFKNRGKIYIGLDSAVGIGHPVTLSVALVLVPLTILIAAILPGNKVLPFADLA
FT                   VIPFALVLIVPITKGNVFRTLIIGIIIITSGLLIATNLAPLFTQMALNASFKMPEGATM
FT                   ISSICDGANPLSWVFVKVMNYKVIGGVVFGVIALGMAIYNRNRIINENKKLSIEE"
FT   CDS             68862..69335
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0033"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01521"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ2"
FT                   /protein_id="CBE01521.1"
FT                   /translation="MKKYKYDSKRYLLSVTIPGFFMILILIYALFNNYINFNLNIYSLL
FT                   IIVCTYGIFNTFISSSNPKKIIIDSKCIHFTSFMTTHKYEIKDIEKIRIREFYNKKIYL
FT                   KINDGDLFKGRYWIRTNMFNNSIALYSYFIELEECLYPDSLRFRNKKFENKNI"
FT   CDS             69507..70157
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0034"
FT                   /product="putative sugar-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01522"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ3"
FT                   /protein_id="CBE01522.1"
FT                   /translation="MLLEKLRKEVLQASLDLLNYNLVTLTGGNVSGRDEQTGYIAITPS
FT                   GMDYRNLTPSDIVIVDVDGNIIDGKWKASVDLSDHLYIYKHREDINSIIHTHSTYSSCF
FT                   AILNEPIECASTTLANEVGGSVPVAKFSPPTFKKMGKCVIEAIGDKRACLLANHGVIAV
FT                   GPSVGHALTAAVMLEDSAKVYYLAKSIGTPVLLPDEEIQRARDVFFNVYGQDK"
FT   CDS             70331..71263
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0035"
FT                   /product="putative lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01524"
FT                   /db_xref="GOA:C9YHJ4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ4"
FT                   /protein_id="CBE01524.1"
FT                   /translation="MYYLLNKSTNPYFNLALEEYLFLNDKYNDDIIIIWRNEDSIFIGK
FT                   NQNPYQEVHHDVIEKGEIPILRRISGGGTVYHDLGNINMSFIQKDRQLHEIDFLEHTKF
FT                   MQKMLSTLGLDVSITERKDLFLNGKKISGSAQSIKRKNSLYHGTLLYDSDLNKLTKYLN
FT                   SNKATESNATKSVSSKVTNIKFLLEKDINYFLDYCVEYLKSNIKNIKELELDEEDIKSV
FT                   YNIGEDKYRKIEWTYGKTPKFQVVLPFNNESKINIHVNRWKVSKFFISYDDNVINMDKL
FT                   LDLNFFKEEIKESILENYPHYIDLINLIF"
FT   CDS             71504..72250
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="CDR20291_0036"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01526"
FT                   /db_xref="GOA:C9YHJ5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ5"
FT                   /protein_id="CBE01526.1"
FT                   /translation="MMVKNKIRGDTMYSVIIVAAGSGRRMNLDINKQFIKLREKEIIAH
FT                   TIQVFYENINIDEIVVCIKKEEEDFFKENIINKYNFKNIKIAYGGKERQDSIYNGLKKL
FT                   DENCDIVLIHDGARPFVDHRIINESIKVAKEKKAVVVGVPVSDTIKIVSDGTVQETPER
FT                   NLLWAAQTPQTFEYNLIIDAYEQAYKNNYYGTDDSMLVENIGQSVTMVMGSYENIKITS
FT                   PEDLNIAEQILNMEKRDEVNSRRRII"
FT   CDS             72247..72732
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="CDR20291_0037"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01527"
FT                   /db_xref="GOA:C9YHJ6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ6"
FT                   /protein_id="CBE01527.1"
FT                   /translation="MRIGLGYDVHKLTENRKLIIGGVEIPHDKGLLGHSDADVLIHAIM
FT                   DSILGALALGDIGKHFPDTDEEYKGADSMKLLEHVYNLITSKGYKIGNIDSTIIAQSPK
FT                   MAPYIESMRSNISKVLNTDIDNINIKATTEEGLGFTGAKQGIASQSICLLLLTSQNN"
FT   CDS             73099..74814
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="CDR20291_0038"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01529"
FT                   /db_xref="GOA:C9YHJ7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ7"
FT                   /protein_id="CBE01529.1"
FT                   /translation="MKMSKMFMPTLKEIPADAEITSHQLMVRSGMIKKMTSGVYNQLPM
FT                   GLRVFKKIEQIIREELNKKDCQEILCAALLPSELWKESGRWTAMGEEMFRLKDRTEREY
FT                   CLGPTHEEAFTDIIRQEITSYKQLPLNLYQIQVKYRDERRPRFGVMRTKTFTMKDAYSF
FT                   DVDDKGLDKSYQDMFDAYVSIFDRCGLENSPVQADSGAIGGSTSAEFMVKSEVGEDEVV
FT                   FCSGCDYAANVERAESCNLASQKEEMKELEEVHTPGAATIKELEEFLKTSPDKFAKTLV
FT                   YEADGKTVVVVVRGDREVNEIKVSNAIGSVIEFALATDDVVRKVTNAEVGFAGPIGINA
FT                   DYVFIDKEIVEQRNIVVGANKTEYHIKNANYGRDFEGIVGDFRNVQEGDQCIVCGKPLE
FT                   IARGVEVGHIFKLGTKYSESMNANFIDKDGKSKPIVMGCYGIGVERTAAAIIEQHNDEK
FT                   GIIWPLSVAPYHVVIVPANMKNEEQISIAENIYNDLQAMGVEVLLDDRDERIGVKFNDS
FT                   ELIGIPMRITVGKNINEGKVEFKLRHKEDKEIIDIEEINEKVKAEFIRNNVRLG"
FT   CDS             74849..76381
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0039"
FT                   /product="putative dual-specificity prolyl/cysteinyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01531"
FT                   /db_xref="GOA:C9YHJ8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ8"
FT                   /protein_id="CBE01531.1"
FT                   /translation="MYFIDTILSIYKDIKWCFFIKQINEEVIEMAKNEKQFVEEITKME
FT                   DDFPQWYTDVITKTDLVDYAPVKGFMVVKPYGYALWEKMQEFMDKKFKETGHKNCYFPL
FT                   LIPESLLNKEAEHVEGFAPEVAWVTHGGNKKLEERLCVRPTSETIICTMYAKWLKSYRE
FT                   LPYLYNQWCSVVRWEKSTRPFLRTSEFLWQEGHTLHETAEEAQEETIQQLEVYKALCEE
FT                   LLAMPVVAGQKSESEKFAGGERTYTIEAMMHDGKALQSGTSHFLGQHFTKAFDITFADR
FT                   EGNLANPYHTSWGASTRLIGGLIMTHSDNRGLVLPPRVAPIQVVIVPIAAKKGNVMETV
FT                   DKIYADLKTKGVAVEVDDRDNYTTGWKFNEWEMKGAPVRVEIGPKDIENNQAMVFRRDT
FT                   LEKDSMPLEGLADAICDLFDVIHNDMFEKARKHREDNTSIVENMDEFRKALEEKPGFIK
FT                   TMWCGDAECEAKIKEETGATIRCLPFEQENLGHKCVYCGKEADSMVVMAKAY"
FT   CDS             76821..78302
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="CDR20291_0040"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01533"
FT                   /db_xref="GOA:C9YHJ9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHJ9"
FT                   /protein_id="CBE01533.1"
FT                   /translation="MNVRVRFAPSPTGFVHIGSLRTALYNYLFAKKMGGEYILRVEDTD
FT                   QSRLVEGAIENMLNAMKWAGVNHSEGVILDDSGKVVQKGEYGPYIQSQRLDIYQEYIKQ
FT                   LLDSGKAYYCFCTKERLDEVRDAQRAAGETAKYDGHCKNLSKEEVEANIKAGIPYVIRL
FT                   RLPENHTIKFTDLVRGDMEFNTNDLDDQVLMKTDGFPTYHFAVVVDDYLMKITHVIRGE
FT                   EWVSSTPKHVYLYEAFGWEAPVFVHLPNILNKEKKKLSKRQGDVAVEDFKKKGYLPEGL
FT                   VNYVALVGWSPEDNQELFTMEELEKAFSVERVSKSGGVFDTEKLNWVNQHYIKDGDDAY
FT                   LTDLAIPFLVEDGFITEEEATNKYDFLKSMISVLKEKLQYVKEITEHASIFFGDKIEVE
FT                   TEEGREFLRLEHIPTLIDALREKIEKTEVLNAEFVQAMLKEIQKEYKIKGKNLFMGSRI
FT                   ILTGQMHGPDLPKVMEVLGKETCLNRIAYVKNNIL"
FT   CDS             78817..80220
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="CDR20291_0041"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01534"
FT                   /db_xref="GOA:C9YHK0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK0"
FT                   /protein_id="CBE01534.1"
FT                   /translation="MSVKVYNTLTRTKEEFVPLEEGKVKMYVCGPTVYNYIHIGNARPF
FT                   IIFDTLRRYLEYRGYDVTYVQNFTDVDDKIINRSHEEGISPEEVAAKYIKEYFVDCDGL
FT                   GIKRATVHPQVTDNIQQIIEFIKELEDKGYAYAVNGDVYFDTNKFEGYGKLSGQKQEDL
FT                   EAGARIEVNDQKRHPMDFVLWKAKKEGEPGWDSPWGEGRPGWHIECSVMSKRYLGETID
FT                   IHAGGQDLTFPHHENEIAQSEARSGKIFSKYWMHNGYININDEKMSKSKGNFFTVRDIS
FT                   KLYDLEIVRFFMLSAHYRNPVNFSDEMLNQAKAGLERLYNTKEKLEFTLSNLVESPLTE
FT                   KEVELVKELDDFRQKFIDAMDDDVNTADAVSVIFELAKLINSNVDENSSLEFAKKCLDE
FT                   FNELTGVLNIVNKKKDTVLDKDIEELIQKRTDAKKNKEFQLADDIRQQLLDMGIVLEDT
FT                   RQGVKWKRI"
FT   CDS             80223..80618
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01536"
FT                   /db_xref="GOA:C9YHK1"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK1"
FT                   /protein_id="CBE01536.1"
FT                   /translation="MEKTELVTMSPLVLAYLGDTVYETYIREYLIRQNTQRKVNDLHKL
FT                   AIKYVKAKAQATIIHEIEIELTEEESKIYKRGRNQKSNTSPKNADIIDYKHATGFEALV
FT                   GYLYLNNEIERLQYIINKGIKIIERDM"
FT   CDS             81126..81956
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0043"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01538"
FT                   /db_xref="GOA:C9YHK2"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK2"
FT                   /protein_id="CBE01538.1"
FT                   /translation="MSLADKIFIDMCNNILENGVSSDGEVVRAKWDDGQPAHTIKKFCV
FT                   VNRYDLSKEFPILTLRPTNLKAAIDELLWIWQKKSNNINDLNSRIWDSWADETGSIGKA
FT                   YGYQIGQKHKYKEGEFDQIDRVIYDLKYNPYSRRIITNIYNHNDLNEMNLYPCAYSMTF
FT                   NVTGNRLNAILNQRSNDILVANNWNVTQYAILVHMLAQISDLEVGELVHVIADAHIYDR
FT                   HIPLVKELINRESYDAPKLIINPNIKNFYDFRVEDFTLENYKSGPQIKKIPVAI"
FT   CDS             81969..82463
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0044"
FT                   /product="dihydrofolate reductase region"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01539"
FT                   /db_xref="GOA:C9YHK3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK3"
FT                   /protein_id="CBE01539.1"
FT                   /translation="MKVIVAVDLNWGIGYGGKLLQSIPEDMKFFKEKTVGNVVVMGRET
FT                   FKSLPGKKALKDRVNIVLTRSKSFNDDRLIVCNSIDETLKELQKYENDKIFIIGGETVY
FT                   KQFLPYCNELYVTKIQKTYEADRFFPNIDIMSNWDLIKESEVKEYNNIRYVFSTYINNS
FT                   L"
FT   CDS             82490..83866
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0045"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01541"
FT                   /db_xref="InterPro:IPR011202"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK4"
FT                   /protein_id="CBE01541.1"
FT                   /translation="MKKDIFVNRVSNALENDRGAVFVGSGISFSSTEVDWFKLLEPLVN
FT                   ELDITLDNKSDDLPMIAQYIVNNYSGNRGPLVNEISKTFNRKFKLNKYHKYLATTKLST
FT                   IWTTNYDMLLEDAFYDFDTSVKVSDDSITRNRLEYDVEIIKMHGCISRSDWNEIVITQE
FT                   DYDDFSINKPAISQRLSEDLINKSFLFIGYSYRDPNIRNIMINARRLSKKHTQQHYIIL
FT                   KKLKDSDSNITQDDVVRQELWCNDLKRLGISTLFIDEYSELEELLREISQKSRGKTVYV
FT                   TGSHKESNMNARKLGTKLAKHKDITLLSGQSSGIGSEVVAAFTEECIKSKEDIINRMKI
FT                   FPNPYSADEKYSDDITLIPDLKKCRTKMLNSTQVVVVFSGGIGTEAEIDVAIKQNCNII
FT                   PVITCKEDRENPAIKKILNYSDNMKNIEIKDATYYNKIVDEDGVVTMEEIYICISKIMN
FT                   "
FT   CDS             84193..84942
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0046"
FT                   /product="thiamine biosynthesis protein thic"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01543"
FT                   /db_xref="GOA:C9YHK5"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK5"
FT                   /protein_id="CBE01543.1"
FT                   /translation="MENGVGMITIHPTANKQIFEDSKNRMVPVTSRGGGMVIQDLISKN
FT                   FSEDNVYLKILPEIIKYAQKHNVCISLGATFRSGNIFDSNDRAQITEIKSQIELAKRIY
FT                   KSNVGVIIESPGHSRPSDIIKISSILKKEGFPIMPLGPIPTDIAIGMDHIAAAIGATIM
FT                   GIEGCANIISTVTREEHTGGRPSIESTVESIRTAKIAAHIIDIHQMNDINLDMSVSKSR
FT                   AKSNTCIFGKDTRYCDRCRELCPLCIR"
FT   CDS             85108..85410
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0047"
FT                   /product="putative thymidylate synthase"
FT                   /EC_number="2.1.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01545"
FT                   /db_xref="GOA:C9YHK6"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK6"
FT                   /protein_id="CBE01545.1"
FT                   /translation="MKKYQEDYDKLVEILFENHYNKLIKGGKNEKTSKRQVEKKAIEDA
FT                   RYVFPNACETKMVFTINARSLFNFFEHRCYENGSCLEGTMTCGDIVQVRKKFKNL"
FT   CDS             85414..86160
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0048"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01546"
FT                   /db_xref="GOA:C9YHK7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK7"
FT                   /protein_id="CBE01546.1"
FT                   /translation="MNNLASIEGRNPVIEAIKSDREIDKILIANSAKEGSIKKIIGMAK
FT                   DKNIIIQYVDKHKLDEVSTSHSHQGVIAYASEYKYYELDELIDLAKNKDEDPFFIILDE
FT                   ITDPHNLGSIIRTADAVGAHGVIIPKRRSVHITPVVAKASAGAVEYMPVCKVTNIVNTI
FT                   KRLKEEGLWIAAADMDGETFYKQNLTGPLGVVIGSEGFGISRLVKQNCDFIVKMPMIGN
FT                   VTSLNASVAGGILLYEIFRQRLDKSK"
FT   CDS             86163..86690
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01548"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK8"
FT                   /protein_id="CBE01548.1"
FT                   /translation="MKKNINHYLIIDGYNIINAWDNLKELAKEDLEDSREKLIDDIIEF
FT                   SEFMGYKTIIVFDAYNVKNSREKVEKRKHITIVYTREHQTADSYIEKFITSLSKYDDVK
FT                   VATNDYAEQQMILGKGATRMSARELKLELDRSKNKMKEKNIGLRKKIQRNWLEERLDKE
FT                   TLSKLENIRRKR"
FT   CDS             86740..87402
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="CDR20291_0050"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01550"
FT                   /db_xref="GOA:C9YHK9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHK9"
FT                   /protein_id="CBE01550.1"
FT                   /translation="MGEIYMLVAKEKSYELVDNCQQDEYNIVLRASEGDKIALEYIITK
FT                   YRNFVKAKAKSYFLIGADKEDIIQEGMIGLYKAVRDFDGSKTNSFKCFAEICITRQIIT
FT                   AIKTATRQKHIPLNSYVSLNKPIYDEESDRTLLDIIATSIVTDPEELIISKEELKNIES
FT                   KMNELLSDLELEVLELYLNGKSYQFIADKLKRDVKSIDNALQRVKRKLEKHLENRND"
FT   CDS             87476..88669
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0051"
FT                   /product="elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01552"
FT                   /db_xref="GOA:C9YHL0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL0"
FT                   /protein_id="CBE01552.1"
FT                   /translation="MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEA
FT                   VDFANIDKAPEERERGITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVCSATDGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYD
FT                   FPGDDTPIVRGSALMALEDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFS
FT                   ITGRGTVATGRVERGVLKVQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGAL
FT                   LRGVQRNEIERGQVLAKTGSVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGACKLPEGIEMVMPGDNVTMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE"
FT   CDS             88919..89068
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="CDR20291_0052"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01553"
FT                   /db_xref="GOA:C9YHL1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL1"
FT                   /protein_id="CBE01553.1"
FT                   /translation="MRVKVTLACTECKQRNYNTTKNKKNNPDRIELQKYCRFCKKHTTH
FT                   KETK"
FT   CDS             89094..89315
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CDR20291_0053"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01555"
FT                   /db_xref="GOA:C9YHL2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL2"
FT                   /protein_id="CBE01555.1"
FT                   /translation="MAAQKNDGAKTKKRFSLFGYLKETKQELKRVTWPTKKELFKNTSI
FT                   VLTVVISCTILVWGIDTILSGALALLLK"
FT   CDS             89335..89877
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CDR20291_0054"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01557"
FT                   /db_xref="GOA:C9YHL3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL3"
FT                   /protein_id="CBE01557.1"
FT                   /translation="MSELQEASWYVVHTYSGHENKVKATIEKAVKTRGMEDCIRQVVVP
FT                   TEEVVETTKTGKEKTRQRKVYPSYVLVKMIITDESWYVVRNTKGVTGFVGPGSKPVPLS
FT                   EDEVKAMGIDTTDPKVVNSDVDFEIGDTVKVSQGPFSGQIGNIEEIDLENREVKVCINA
FT                   FGKRTLFVIELEGIEKI"
FT   CDS             89913..90338
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CDR20291_0055"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01558"
FT                   /db_xref="GOA:C9YHL4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL4"
FT                   /protein_id="CBE01558.1"
FT                   /translation="MAKKVIGQIKLQIPAGKATPAPPVGPALGQHGVNIMGFTKEFNAK
FT                   TADQAGMIIPVVITVYQDRSFSFITKTPPAAVLIKKALNLKSGSGEPNKKKVAKMTSAQ
FT                   VREIAELKMPDLNAASVEAAMSMIAGTARSMGVVIED"
FT   CDS             90408..91106
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CDR20291_0056"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01560"
FT                   /db_xref="GOA:C9YHL5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL5"
FT                   /protein_id="CBE01560.1"
FT                   /translation="MAKKGKRYAGALQKVDRTKFYDASEALTLVSDIAGAKFDETVEAH
FT                   IKLGVDSRHADQQVRGAVVLPHGTGKTKRVLVFAKGEKAKEAEQAGADFVGAEELVQKI
FT                   QGENWFDFDIVVATPDMMGVVGRLGRVLGPKGLMPNPKSGTVTFDVAKAIDEIKAGKVE
FT                   YRLDKTNIIHVPVGKVSFGGEKLTENFTALMDAIIKAKPAAAKGQYLRSITVASSMGPG
FT                   VKINPARTAE"
FT   CDS             91329..91835
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CDR20291_0057"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01562"
FT                   /db_xref="GOA:C9YHL6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL6"
FT                   /protein_id="CBE01562.1"
FT                   /translation="MRKAIEIKSEVVSEIVEKLQKSSAAVVVDYKGLTVEEVTELRKQM
FT                   REAGVDYKVYKNTLVRRAAKEVGIEQFNDELLVGTNAIAFGYDDPVAPARILKGFMDSH
FT                   PKMKLKMGIVEGAFYDESKIVEMANIPSREVLIAKLLGSLKAPVSNFAYLIDAIAKKAE
FT                   GQEEA"
FT   CDS             91893..92258
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="CDR20291_0058"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01563"
FT                   /db_xref="GOA:C9YHL7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL7"
FT                   /protein_id="CBE01563.1"
FT                   /translation="MTIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVAGAAAG
FT                   GPAAEEKTEFDVVLTDVGSSKVGVIKAVREITGLGLKEAKEVVDNAPKTVKEGASKEEA
FT                   DQIKEKLEAAGAKVEVK"
FT   CDS             92650..93438
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0059"
FT                   /product="NADP-dependent 7-alpha-hydroxysteroid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01565"
FT                   /db_xref="GOA:C9YHL8"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL8"
FT                   /protein_id="CBE01565.1"
FT                   /translation="MEKLQGKIAVVTAATKGIGLASAEILAKNGATVYLAARSEELANE
FT                   VINKISAEGGCAKFVYFNAREEETFTSMIEEVVKKEGKIDILVNNFGSTNPSLDKDLVT
FT                   GDTDNFFDTVNTNLKSVYLPCKAAIPHMIKNGKGSIVNISSIGSVLPDLSRIAYCVSKA
FT                   AINSLTQNIATQYAKDNVRCNAVLPGLIATKAALDNMSPEFIKEFLKHVPLNRIGEPDD
FT                   IAKAVLFYASDDSSFITGDLLEVAGGFGLPTPQFADNILG"
FT   CDS             93909..97625
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CDR20291_0060"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01567"
FT                   /db_xref="GOA:C9YHL9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL9"
FT                   /protein_id="CBE01567.1"
FT                   /translation="MPHPVTIGKRTRMSFSKIKEIADVPNLIEIQVDSYEWFLKEGLKE
FT                   VFDDISPIEDYTGNLILEFVDYSLDDKPKYDIEECKERDATYCAPLKVKVRLINKETGE
FT                   IKEQEVFMGDFPLMTERGTFVINGAERVIVSQLVRSPGVYYAEERDKTGKRLISSTVIP
FT                   NRGAWLEYETDSNDVISVRVDRTRKQPVTVLLRALGIGTDAEIIDLLGEDERLSATLEK
FT                   DNTKTVEEGLVEIYKKLRPGEPPTVESASSLLNALFFDPKRYDLAKVGRYKFNKKLALC
FT                   YRIMNKISAEDIINPETGEVFVKAGEKISYDLAKAIQNAGINVVNLLMDDDKKVRVIGN
FT                   NFVDIKSHIDFDIDDLNIKEKVHYPTLKEILDGYSDEEEIKEAIKSRIKELIPKHILLD
FT                   DIIASISYEFNIFYNIGNIDDIDHLGNRRIRSVGELLQNQVRIGLSRMERVIKERMTVQ
FT                   DMEAITPQALVNIRPVSAAIKEFFGSSQLSQFMDQTNPLSELTHKRRLSALGPGGLSRE
FT                   RAGFEVRDVHHSHYGRMCPIETPEGPNIGLINSLGTYAKINEFGFIESPYRKFDKETST
FT                   VTDEIHYLTADEEDLFVRAQANEPLTEDGKFVNHRVVCRTVNGAVEMVPESRVDYMDIS
FT                   PKQVVSVATAMIPFLENDDANRALMGANMQRQAVPLVRREAPIIGTGIEYRAAKDSGAV
FT                   VVARNSGIAERVTADEIIIKREDGNRDRYNLLKFKRSNSGTCINQTPIINKGDQIIKGD
FT                   VIADGPATDLGEVALGRNCLIAFMTWEGYNYEDAILINERLVKEDRLSTIHIEEYECEA
FT                   RDTKLGPEEITRDIPNVGDSAIKNLDDRGIIRIGAEVDSGDILVGKVTPKGETELTAEE
FT                   RLLRAIFGEKAREVRDTSLKVPHGESGIIVDVKVFTRENGDDLSPGVNELVRCYIAKKR
FT                   KIKVGDKMAGRHGNKGVISRVLPEEDMPFMENGTPLDIILNPQGIPSRMNIGQVLEVHL
FT                   GLAAKTLGWYVATSVFDGANEYDIMDALEEAGYPRDGKLTLYDGRTGQSFDNRITVGYM
FT                   YYLKLHHLVDEKLHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAHILQE
FT                   ILTVKSDDVVGRVRTYEAIVKGENIPEPGIPESFKVLIKELQSLCLDVKVLTDEDQEIE
FT                   VRESVDEDDTIGEFELDVVNHMGEVEESNIIEEIEDDFVEATEDEDIENLEEFTEDDLF
FT                   EEEIDFESDDFDM"
FT   CDS             97667..101152
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CDR20291_0061"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01568"
FT                   /db_xref="GOA:C9YHM0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM0"
FT                   /protein_id="CBE01568.1"
FT                   /translation="MFELNNFESIKIALASPEKIRQWSRGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYRRVRYKGVVCDRCGVEVTKSKVRRERMGHIELAAPMSHI
FT                   WYFKGIPSRMGLLLDMSPRSLEKILYFASYVVVDPGETGLNEKQLLTEKEYRTALEKYG
FT                   YTFTVGMGAEAVKTLLQNIDLEQQSKDLRAELKDSTGQKKVRTIRRLEVVEAFKKSGNK
FT                   PEWMILDAIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLELGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKFYQCGLPKKMALELFKPFVMDKLVKEGYAHNIKSAKSIVEKVKPEVWD
FT                   VLEDVIKSHPVLLNRAPTLHRLGIQAFEPILVEGKAIKLHPLVCTAYNADFDGDQMAVH
FT                   VPLSVEAQAEARFLMLSVNNILAPKDGSPITTPSQDMVLGCYYLTIEAQDGAKGTGMVF
FT                   KDFNELLLAYYNKSVHLHALVKLKVTLEDGRSSLVESTVGRFIFNENIPQDLGFVDRKE
FT                   NPFALEVDFLADKKSLGKIIDKCFRKHGNTETAELLDYIKALGFKYSTLGGITVAVDDM
FT                   SVPEEKKVFIAEAEAKVDKYEKAYRRGLISDEERYEKVIETWTETTDKVTDALMGGLDR
FT                   LNNIYIMAHSGARGSKNQIRQLAGMRGLMANASGKTVEIPVKSNFREGLSVLEYFTSSH
FT                   GARKGLADTAIRTAESGYLTRRLVDVSQDVIVREIDCGTEDTTEIYAIKEGNEVIEEIY
FT                   DRIVGRYTIDPILNPETGEVLVEADSMIQEDEAETIVALGIEKIRIRTVLNCKTNHGVC
FT                   SKCYGRNLATGKEVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGADITQGLPRVEE
FT                   LFEARKPKGLAVITEVSGRVEIDETGKRKEVNVIPEEGETQTYVIPYGSRLKVKQGQML
FT                   EAGDPLTQGFINPHDIVRVNGVKGVQEYIVKEVQRVYRLQGVDVNDKHIEVIVRQMLSK
FT                   VKVEDPGDTDLLPGGYEDVLTFNECNKDAIDKGLRPAVAKRVLLGITKASLATDSFLSA
FT                   ASFQETTRVLTEAAIKGKEDHLIGLKENVILGKLIPAGTGMKKYRNIAVEKIED"
FT   CDS             101438..101863
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CDR20291_0062"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01570"
FT                   /db_xref="GOA:C9YHM1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM1"
FT                   /protein_id="CBE01570.1"
FT                   /translation="MMPTINQLVRKSRKALEKKSTAPALQKGYNSLNKKVTDASAPQKR
FT                   GVCTSVKTVTPKKPNSALRKVARVRLTNGIEVSAYIPGEGHNLQEHSVVLIRGGRVKDL
FT                   PGVRYHILRGTLDTAGVDKRRQSRSKYGAKRPKEAKK"
FT   CDS             101986..102456
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CDR20291_0063"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01572"
FT                   /db_xref="GOA:C9YHM2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM2"
FT                   /protein_id="CBE01572.1"
FT                   /translation="MPRKGNIPKREVLPDPMYGSKVVTKLINNLMVDGKKGKSQRIVYD
FT                   AFAIVAEKTGEEALEVFNKAMDNIMPVLEVKARRVGGANYQVPIEVRPERRQTLGLRWL
FT                   VKYTRARGEKGMVEKLAKEIMDAANNTGASVKKKEDTHKMAEANKAFAHYRW"
FT   CDS             102505..104571
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CDR20291_0064"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01574"
FT                   /db_xref="GOA:C9YHM3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM3"
FT                   /protein_id="CBE01574.1"
FT                   /translation="MARKFPLEKTRNIGIMAHIDAGKTTTTERILFYTGQTHKIGETHE
FT                   GASQMDWMEQEKERGITITSAATTASWKDHRINIIDTPGHVDFTVEVERSLRVLDGSVA
FT                   VFCAKGGVEPQSENVWRQAETYGVPRIAFINKMDILGADFYNVISMMKSRLNSNAVPMQ
FT                   LPIGKEDSFIGIIDLLKMDAVIYKDDLGVEMEETDIPEDMKELAAEWREKLVESVAETD
FT                   EELMMKYLEGEELTIDELKVAIRKATIACEMNPVFCGTAYRNKGVQLVIDAVLDYLPAP
FT                   TDIPAIKGILADGEEAERHSSDEEPFSALAFKIMTDPFVGKLAFFRVYSGTLESGSYVL
FT                   NATKNKRERIGRILQMHANTREEITKVYAGDIAAAVGLKDTTTGDTLCDPANPIILESM
FT                   EFPEPVISVAIEPSSKAAQEKMGIALQKLAEEDPTFTVKTDQETGQTIISGMGELHLEI
FT                   IVDRLLREFKVEAKVGAPQVAYRETITQPVDVEYKYSKQSGGRGQYGHVKIRVAPQEPG
FT                   EGYKFTNKTVGGSVPKEYVGPVDMGIQGAMQSGIVAGYPVVDVAVELYDGSYHEVDSSE
FT                   MAFKMAGSMAFKDAMKKGNAVLLEPYFKVEVVTPEDYMGDVMGDLNSRRGLIQGMEARS
FT                   GAQVINAFVPLSEMFGYSTDLRSSTQGRATYTMIFDHYEQVPASVAKKIAEGK"
FT   CDS             104662..105855
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0065"
FT                   /product="elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01575"
FT                   /db_xref="GOA:C9YHL0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHL0"
FT                   /protein_id="CBE01575.1"
FT                   /translation="MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITKTLYDRYQLGEA
FT                   VDFANIDKAPEERERGITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVCSATDGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLTEYD
FT                   FPGDDTPIVRGSALMALEDPKSEWGDKIVELFEQIDEYIPAPERDTDKPFLMPVEDVFS
FT                   ITGRGTVATGRVERGVLKVQDEVELVGLTEAPRKVVVTGVEMFRKLLDQAQAGDNIGAL
FT                   LRGVQRNEIERGQVLAKTGSVKAHTKFTAEVYVLKKEEGGRHTPFFDGYRPQFYFRTTD
FT                   VTGACKLPEGIEMVMPGDNVTMEVDLINSIVVEEGLRFSIREGGRTVASGVVATIIE"
FT   CDS             106228..106539
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="CDR20291_0066"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01577"
FT                   /db_xref="GOA:C9YHM5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM5"
FT                   /protein_id="CBE01577.1"
FT                   /translation="MAKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPT
FT                   EKQVVTILRAVHKYKDSREQFEIRTHKRLIDIANPTPKTVDSLMRLDLPAGVDIEIKL"
FT   CDS             106631..107260
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="CDR20291_0067"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01579"
FT                   /db_xref="GOA:C9YHM6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM6"
FT                   /protein_id="CBE01579.1"
FT                   /translation="MKGILGKKVGMTQIFTDKGVVIPVTAVEAGPMVVTQIKTVDKDGY
FT                   NAIQIGFEDAKEKALNKPKKGHLAAANVLKKHLKEFRVDSVEGYTVGQEIKADVFEAGA
FT                   KIDVTGISKGKGFQGPIKRHGQSRGPETHGSRYHRRPGSMGACSYPGRVFKNKKLAGHM
FT                   GSVKVTVQNLEVVKVDADKNLILVKGAIPGAKGSVVTIKEAIKVSK"
FT   CDS             107260..107913
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="CDR20291_0068"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01581"
FT                   /db_xref="GOA:C9YHM7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM7"
FT                   /protein_id="CBE01581.1"
FT                   /translation="MTNLEKGGITMPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYE
FT                   VVKNQLANKRQGTQSAKTRAEVRGGGRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKP
FT                   RSYKYTLPKKVRRLAMKSALSSKVQNSEVIVLDALNMDAPKTKEFAQILNNINAAKKAL
FT                   VVIADKNDNVIKSARNIEGVQTALVNTMNVYDILKYDSFIITTDAVKKVEEVYA"
FT   CDS             107913..108203
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="CDR20291_0069"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01582"
FT                   /db_xref="GOA:C9YHM8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM8"
FT                   /protein_id="CBE01582.1"
FT                   /translation="MTNPHDVIIRPVVTEHSMAEMGEKKYTFVVAKDANKTEIKKAVEK
FT                   VFGVSVDKVNTLNYDGKVKRMGRTQGRTASFKKAVVKLTADSKEIEFFQGM"
FT   CDS             108233..109063
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="CDR20291_0070"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01584"
FT                   /db_xref="GOA:C9YHM9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHM9"
FT                   /protein_id="CBE01584.1"
FT                   /translation="MAIKKFRPTSPALRQMTVLVSDEITCNQPEKSLLVNLKKNAGRNV
FT                   HGRITVRHRGGGQKRKYRIIDFKRDKDGIPAKVATIEYDPNRTANIALLNYADGEKRYI
FT                   LAPVGINVGDTILSGLGADIKPGNCLALKDMPVGTIIHNIELKPGKGAQLVRSAGVSAQ
FT                   LMAKEGKNALLRLPSGEMRLVSINCKATIGQVGNIEHGNVVIGKAGRKRHMGIRPTVRG
FT                   SVMNPNDHPHGGGEGRSPIGRPSPVTPWGKPALGYKTRKKNKASNKLIVSRRTK"
FT   CDS             109098..109379
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CDR20291_0071"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01586"
FT                   /db_xref="GOA:C9YHN0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN0"
FT                   /protein_id="CBE01586.1"
FT                   /translation="MSRSTKKGPFVHARLLKKIEAMNASGNKEVIKTWSRSSTVFPQMV
FT                   ENTIAVHDGRKHVPVYITEDMVGHKLGEFVPTRTFKGHKDDEKSNKRK"
FT   CDS             109411..109746
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="CDR20291_0072"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01588"
FT                   /db_xref="GOA:C9YHN1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN1"
FT                   /protein_id="CBE01588.1"
FT                   /translation="MEAKATAKYVRVSPRKAGQICDLVRGKNVDEALAILKFTPRGAAS
FT                   IIAKVVKSAKANAENNHEMDTEKLYIASIVANQGPTMKRFMPRAMGRATTIRKRTSHIE
FT                   VVVKEKK"
FT   CDS             109769..110584
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="CDR20291_0073"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01590"
FT                   /db_xref="GOA:C9YHN2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN2"
FT                   /protein_id="CBE01590.1"
FT                   /translation="MGQKVNPHGLRVGVIKDWDSRWFATDKKEFGNLLLEDHNIRKFLK
FT                   KRLYSAGVAKIEIERSANKIKMDLHVAKPGVVIGRAGAGIEALKAELEKMTKKTIIVNI
FT                   VEVRSTDKNAQLVAENIALAIERRVAFRRAMKQAIQRAMKSGAKGIKVSASGRLGGAEM
FT                   ARTEGYSEGNVPLQTLRADIDYGFAEADTTYGKIGIKVWICNGEVLPTRDGVNPREESR
FT                   KSDRRDNKRDNRRNDRRGNDRRGNDNRGNYRGQRPQGGSRPQRTENKGN"
FT   CDS             110620..111051
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="CDR20291_0074"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01591"
FT                   /db_xref="GOA:C9YHN3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN3"
FT                   /protein_id="CBE01591.1"
FT                   /translation="MLMPKRVKRRRVHRGSMAGQAHKGNKVTYGEFGLVALEASWITSN
FT                   QIEAARIAMTRYIKRGGKVWIKIFPHKPVTRKPAETRMGAGKGSPEYWVAVVKPGRVMF
FT                   ELAGVSEDKAREAMRLAAHKLPIKCKFVKKEDLEVKGGE"
FT   CDS             111053..111256
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="CDR20291_0075"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01593"
FT                   /db_xref="GOA:C9YHN4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN4"
FT                   /protein_id="CBE01593.1"
FT                   /translation="MKAKELRDLTSEELMNKLNDFKSELFSLRFQLATGQLENTARIKF
FT                   VKKDIAKVKTVLAERKLYETRA"
FT   CDS             111280..111534
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="CDR20291_0076"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01595"
FT                   /db_xref="GOA:C9YHN5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN5"
FT                   /protein_id="CBE01595.1"
FT                   /translation="MERGRRKVRIGRVVSDKMDKTIVVAVEEFVRHPLYNKRVKRTKKF
FT                   KAHDEKNICNIGDRVKIMETRPLSKDKRFRLVEVVEKVK"
FT   CDS             111560..111928
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="CDR20291_0077"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01597"
FT                   /db_xref="GOA:C9YHN6"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN6"
FT                   /protein_id="CBE01597.1"
FT                   /translation="MIQQESRLRVADNSGAKELLCIRVLGGSKRRYGNIGDVIVATVKS
FT                   ATPGGVVKKGKVVKAVIVRSKQGVRRNDGSYISFDENAAVIIKDDKTPVGTRIFGPVAR
FT                   ELRDNEFMKIVSLAPEVL"
FT   CDS             111949..112257
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="CDR20291_0078"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01599"
FT                   /db_xref="GOA:C9YHN7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN7"
FT                   /protein_id="CBE01599.1"
FT                   /translation="MMRVKKGDTVVVIAGKDKGKKGSVLKVYPKTSKVLVEGVNVITKH
FT                   QKPSAMNQQGGIINKEAPIHISNVMPFDPETGKGVRVRYEVKDGNKVRVSAKSGKEL"
FT   CDS             112287..112829
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="CDR20291_0079"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01600"
FT                   /db_xref="GOA:C9YHN8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN8"
FT                   /protein_id="CBE01600.1"
FT                   /translation="MASRLQEKYMKEVAPALMEKFGYKNVMEIPKLNKIVINMGIGDAR
FT                   ENPKGLEKGVEELEMISGQKPVITKARKSVANFKLREGMPIGTKVTLRADKMFYFMDKL
FT                   VSVSLPRVRDFRGVNPNAFDGRGNYALGVKEQLIFPEIEYDKIDKVRGMDIIFVTTAKT
FT                   DEEARELLKLLGMPFSK"
FT   CDS             112847..113032
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="CDR20291_0080"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01602"
FT                   /db_xref="GOA:C9YHN9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHN9"
FT                   /protein_id="CBE01602.1"
FT                   /translation="MARKAMVVKQQRKQKYATREYTRCTICGRPHSVLKKFGICRICFR
FT                   ELAYKGQIPGVRKASW"
FT   CDS             113065..113463
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="CDR20291_0081"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01604"
FT                   /db_xref="GOA:C9YHP0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP0"
FT                   /protein_id="CBE01604.1"
FT                   /translation="MTMTDPIADMLTRIRNANVVKHETVDVPASNMKKELARILLEEGF
FT                   IRGYDVIEDGKQGIIRIQLKYGQEGERVITGLKKISKPGMRVYAANHEIPKVLNGLGIS
FT                   VISTSKGILTDKQARKENVGGEVICYVW"
FT   CDS             113494..114036
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CDR20291_0082"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01605"
FT                   /db_xref="GOA:C9YHP1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP1"
FT                   /protein_id="CBE01605.1"
FT                   /translation="MSRIGVKPIIIPAGVEVTIAEGNLVTVKGPKGTLTKQLSAELNIK
FT                   KEENTIMVERPTDNKKHRSLHGLTRTLLDNMVVGVNTGFEKKLELKGVGYRAQKQGKKL
FT                   VMNLGFSHPVEMEDPEGITVEAPNQTELIVKGIDKQLVGNYAAKIRAWRKPEPYKGKGI
FT                   KYVDEVIRRKEGKTGKK"
FT   CDS             114072..114440
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="CDR20291_0083"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01607"
FT                   /db_xref="GOA:C9YHP2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP2"
FT                   /protein_id="CBE01607.1"
FT                   /translation="MLKKADKNANRLQRHKRVRRKISGTSQRPRLCVFRSANNIYAQII
FT                   DDTKRVTLVAASSLEAEVKSAVNHTGNKEAAKKVGELVAKKAVEKGITEVVFDRGGYLY
FT                   HGRIQELAEGAREAGLKF"
FT   CDS             114461..114970
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="CDR20291_0084"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01609"
FT                   /db_xref="GOA:C9YHP3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP3"
FT                   /protein_id="CBE01609.1"
FT                   /translation="MLRRKPIDAGQLDLQEKVVEVRRVTKVVKGGRNFRFAALVVVGDE
FT                   NGHVGIGAGKAMEVPDAIKKAVEDAKKNLIVVPIVGTTIPHEVRGHFGAGNILIMPAVE
FT                   GTGVIAGGPARAVLELAGLKDVRAKSLGSNNPRNMVNATIEGLNSLKTVEDIAKLRGKK
FT                   VEELLG"
FT   CDS             114985..115170
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="CDR20291_0085"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01610"
FT                   /db_xref="GOA:C9YHP4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP4"
FT                   /protein_id="CBE01610.1"
FT                   /translation="MAKLQIKLVRSVIGTTPNQKKNVEALGLRKREQVVVKEDNAQTRG
FT                   MINKVSHLLEVTEIAE"
FT   CDS             115203..115646
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="CDR20291_0086"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01612"
FT                   /db_xref="GOA:C9YHP5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP5"
FT                   /protein_id="CBE01612.1"
FT                   /translation="MKLHELKPAEGAVRAKRRLGRGTATGQGKTAGRGQKGQWSRSGGG
FT                   VRVGFEGGQMPLARRLPKRGFNNIFKKVYTEVNVEVLNRFENGTEITAELLKSTKTISK
FT                   IGKDGIKILGEGNLEKALTVKAAKFTASAQEKIEKAGGKAELV"
FT   CDS             115690..116958
FT                   /transl_table=11
FT                   /gene="prlA"
FT                   /locus_tag="CDR20291_0087"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01614"
FT                   /db_xref="GOA:C9YHP6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP6"
FT                   /protein_id="CBE01614.1"
FT                   /translation="MLSKLKQAWKIKAVRKKVMYTLMMIVIFRIGTTIPVPGIDTSIIQ
FT                   KMVGGNSLLSLYNMFTGGAFSNFSLFALGISPYITASIIIQLLTVGFESLAELQKSGEE
FT                   GKKKINKYTKYTALALAVVQALGITLGIVRSALISNSVFFITTVVITLVSASMLVMWIG
FT                   DKITEKGIGNGSSVIIFAGIISRIPTDVIKISQQVKSGEVAPWVIVILAVVILLTVTGV
FT                   TFIQEATRKIPVQYAKRVVGRKMYGGQSSHIPMKVNQSGVMPIIFASSLLAFPQTIAMF
FT                   MGPNAQAFVQKYLSMATEQGFWTYRSIEILLIIFFSYFYTTVSFNTEDISKNMKNNGGF
FT                   IPGIRPGEPTMDYLNRILTRLTLAGATFLAIIAMVPALTTHYMKVNMSLAGTSLLIVVG
FT                   VALELKRQLESNLVMRSYQGFLK"
FT   CDS             116960..117625
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="CDR20291_0088"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01615"
FT                   /db_xref="GOA:C9YHP7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP7"
FT                   /protein_id="CBE01615.1"
FT                   /translation="MEMDNMRIILLGPPGAGKGTQAAGIVEKYNIPHISTGDIFRKNIK
FT                   EGTELGKKAKEYMDQGLLVPDELTVGLVTDRISQEDCKNGFMLDGFPRNVAQGEHLDIF
FT                   LKNAGISLDKVVNIEVDKSILVSRAVGRRICKSCGATYHVEFNPPKVEGVCDVCQGELY
FT                   QRADDNEETVSKRIQVYLDETKPLVDYYSKQGIIADIKGDQAIDKVFEDIVAALGSGK"
FT   CDS             117626..118372
FT                   /transl_table=11
FT                   /gene="map1"
FT                   /locus_tag="CDR20291_0089"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01616"
FT                   /db_xref="GOA:C9YHP8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP8"
FT                   /protein_id="CBE01616.1"
FT                   /translation="MIILKSKKEIELLREAGKIVADTHEVLRKAISPGISTLELDKIAE
FT                   ENIRKYNAEPSFKGYGGFPGSICASINREVVHGIPGETILQEGDIVSLDIGAYYKGYHG
FT                   DSAKTHGVGMISEEDRKLIEVTRESFYEGIKFAKLGYRLSDISHAVQTHVEKHGFSVVR
FT                   DLVGHGVGANLHEDPQVPNYGLPGKGPRLREGMVIAIEPMVNAGRYHVKTLSDGWTTVT
FT                   IDGKKSAHYEHTIAITEHEPLILTKL"
FT   CDS             118385..118663
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0090"
FT                   /product="putative ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01618"
FT                   /db_xref="GOA:C9YHP9"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHP9"
FT                   /protein_id="CBE01618.1"
FT                   /translation="MKKVLSDNLSIGQVVKVSLGRDKGNLFFVVKIINNEYVLIADGKK
FT                   RKLDKPKLKKVKHLKKYDFINDEVRKRVVSGQEITDSFLRAELTKLN"
FT   CDS             118701..118919
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="CDR20291_0091"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01620"
FT                   /db_xref="GOA:C9YHQ0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ0"
FT                   /protein_id="CBE01620.1"
FT                   /translation="MAKKDVIELEGTVSEALPNAMFKVKLENGHEILCHISGKLRMNFI
FT                   RILEGDKVNVELSPYDLTRGRITWRKK"
FT   CDS             118955..119068
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="CDR20291_0092"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01622"
FT                   /db_xref="GOA:C9YHQ1"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ1"
FT                   /protein_id="CBE01622.1"
FT                   /translation="MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQKQG"
FT   CDS             119221..119592
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="CDR20291_0093"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01623"
FT                   /db_xref="GOA:C9YHQ2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ2"
FT                   /protein_id="CBE01623.1"
FT                   /translation="MARIAGVDLPREKRAEIGLTYIYGIGKATANEILAKAEINPDTRI
FT                   KDLSEDQVNELRKVIDDDFLVEGDLRREIALNIKRLRDIKCYRGIRHAKGLPLRGQRTK
FT                   TNARTRKGPRKTVSRKKKK"
FT   CDS             119628..120026
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="CDR20291_0094"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01625"
FT                   /db_xref="GOA:C9YHQ3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ3"
FT                   /protein_id="CBE01625.1"
FT                   /translation="MAKPKKKVTRIRRRERKNIERGHAHIQSTFNNTIITLTDVHGNAI
FT                   SWASSGQLGFKGSRKSTPFASQMAAETAAKAAMEHGLKSVEVFVKGPGSGREAAIRALQ
FT                   ATGLEVTMIKDVTPIPHNGCRPPKRRRV"
FT   CDS             120058..120681
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CDR20291_0095"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01627"
FT                   /db_xref="GOA:C9YHQ4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ4"
FT                   /protein_id="CBE01627.1"
FT                   /translation="MARYTGASCRQCRREGMKLFLKGDRCYTDKCAIVKRNYAPGQHGQ
FT                   GRKKVSNYGLQLREKQKVKRIYGVLETQFRNLYERAENMPGKAGENLLSLLERRLDNVV
FT                   YRMGLASSRKEARQLVTHGHFTLNGNKVDIPSLIVKVGDVIEVKEKSRSSAKFKNLVEV
FT                   NSRIAPKWLEANVEGMTAKVVGVPTREDIDLEIAEHLIIELYSK"
FT   CDS             120759..121706
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CDR20291_0096"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01629"
FT                   /db_xref="GOA:C9YHQ5"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ5"
FT                   /protein_id="CBE01629.1"
FT                   /translation="MIEIEKPKVDIVELSEDYRYGKFVIEPLERGYGITIGNALRRILL
FT                   SSLPGVAVNAIKIDGVLHEFSTIPGVKEDVTEIILTLKELSATIDGEGSRTLKIEAQGP
FT                   CSITGADIICPPDVEILSKDLAIATLDDNAKLNMEIFVDKGRGYVSAEENKTENVPIGV
FT                   LPVDSIYTPVEKVSYHVENTRVGQKTDYDKLVLEVWTNGSINPQEGISLAAKVLVEHLN
FT                   LFIDLTEHVSSVEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVEELANKS
FT                   EDDMMKVRNLGKKSLEEVIQKLEELGLGLKPSEE"
FT   CDS             121727..122068
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="CDR20291_0097"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01631"
FT                   /db_xref="GOA:C9YHQ6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ6"
FT                   /protein_id="CBE01631.1"
FT                   /translation="MAKYRKLGRETAHRNLMLRNLVTCLLRSGRIETTVTRAKETRRMA
FT                   EKMITLAKRGDLHARRQVLAYVMDETVVNNLFTDLAPKYAERNGGYTRIIKIGPRKGDA
FT                   AEMAFIELV"
FT   CDS             122188..123021
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0098"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01632"
FT                   /db_xref="GOA:C9YHQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ7"
FT                   /protein_id="CBE01632.1"
FT                   /translation="MDNIVKVNNISFEYITDEAKLKAIDNLSLDVKKGEFVAIIGHNGS
FT                   GKSTLSKNLNAILMPTEGNILIDDMDTKEEERLWDIRQTAGMVFQNPDNQIVATIVEED
FT                   VAFGPENLGIEPKEIRRIVEESLKSVGMYDLRDRQPHLLSGGQKQRVAIAGIIAMRPKC
FT                   IIFDEATAMLDPSGRKEVMKTIKRLNKEENITVIHITHFMEEAVEADRVVVMEKGKKIL
FT                   EGTPREVFSKIKMLKEIGLDVPCMTELSSLLIEEGINISSDILTVDEMVMELCQL"
FT   CDS             123054..123875
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0099"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01634"
FT                   /db_xref="GOA:C9YHQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ8"
FT                   /protein_id="CBE01634.1"
FT                   /translation="MPFASKALDDISFEIKDRDFVGLIGHTGSGKSTLIQHLNGLLKPS
FT                   SGEIFINDFNITDKNLNLTEIRKRVGVVFQYPEYQLFEETIDKDIAFGPSNLGLEESEI
FT                   HNRVKASMEAVGLDYEGFKDKSPFELSGGQKRRVAIAGVIAMNPEVLILDEPTAGLDPG
FT                   GRDEIFNLIKDLHEKKNMTIILSSHSMDDMAKLAKTLIVMNHGSVEFMGTPREVFKSNA
FT                   SKLKDIGLDIPQVLELALKLREKGFDISEDILTLEEAKQEILKVVRGRGLC"
FT   CDS             123965..124672
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0100"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01636"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHQ9"
FT                   /protein_id="CBE01636.1"
FT                   /translation="MVSIFVVNKFWPYIVVLLCLLAMIKLANIPVKYIVKGVKPLKWII
FT                   LFTFLINIFFLPGDEIWSFGFLAITKQGLRQAIFMAIRLIFLVVGTSLLTLTTSPIELT
FT                   DGIERLLNPFKKIGLPVHELAMMMTIALRFIPTLLDETDKIMKAQMSRGADFESKNLIN
FT                   RAKNLVPLLVPLFVSAFRRADELAMAMEARCYRGGHNRTKMRESVISRRDYMACVFQVV
FT                   YLGAIIATRFIAI"
FT   CDS             124704..125435
FT                   /transl_table=11
FT                   /gene="truA1"
FT                   /locus_tag="CDR20291_0101"
FT                   /product="tRNA pseudouridine synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01638"
FT                   /db_xref="GOA:C9YHR0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR0"
FT                   /protein_id="CBE01638.1"
FT                   /translation="MRNIKIKIQYNGKNYCGWQKQPDSLGIQGTIERAIYDITKEETSL
FT                   IGSGRTDSGVHAIGQIANFKINSGISIESIPMALNAKLPKDISVIEACEVNDDFHSRYS
FT                   AKGKTYKYLVYNSKFRNPILSEISYQVKYELDFDKMCSEAKSLLGTHDFKGFMSSGSSV
FT                   KDTVRTIYDIDISKKDDLITFEISGNGFLYNMVRIIVGTLVDMGRGRINEPFLDIIQSK
FT                   TRSRCGHTAPAQGLFLKKVHY"
FT   CDS             join(125555..125869,125871..125897)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0102"
FT                   /product="50S ribosomal protein L13 (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01639"
FT                   /protein_id="CBE01639.1"
FT                   /translation="MKSYIAKPADVQRKWYLVDAEGKTLGRLATEIATVLRGKHKPTFT
FT                   PHVDGGDFVVVVNAEKIVLSGKKLDQKYYRYHTGYVGGLKEISYRDMMDKKPEEVISHA
FT                   VAVCYLKIN"
FT   CDS             126015..126407
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="CDR20291_0103"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01641"
FT                   /db_xref="GOA:C9YHR2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR2"
FT                   /protein_id="CBE01641.1"
FT                   /translation="MANVQYYGTGRRKSSVARVRLVAGEGNILVNGRALENYFNYETLI
FT                   RDVKQPLVLTGNENKYDVIVKVEGGGFTGQAGAIRHGISRALLKADLDLRPALKKEGFL
FT                   TRDARMKERKKYGLKAARRAPQFSKR"
FT   CDS             126866..127618
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="CDR20291_0104"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01643"
FT                   /db_xref="GOA:C9YHR3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR3"
FT                   /protein_id="CBE01643.1"
FT                   /translation="MEYYSVFISIHIQGDVVRKYIKHIIFSFAMICLVVVSIFEIKNIS
FT                   EDVIKYMPVTNKTIILDAGHGGIDPGALNKDKSTSEKDINLAITLKLRELIESSGGLVI
FT                   LTREDDSSLYKEENNKTTRQKYNENLKNRKEIISNSNANMFVSIHLNAFEQSKYYGAQT
FT                   FYPKDKQDSKELSKCIQEELKRVVDKTNNREVKPRDDIYLLKENNIPSVLIECGFLSNE
FT                   KECKLLTDETYQEKIAWAIYIGIQKYLS"
FT   rRNA            127805..129435
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            129786..132416
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   gap             132816..132915
FT                   /estimated_length=unknown
FT   rRNA            133029..134660
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            135270..137865
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            137938..138054
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS             complement(138268..139452)
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="CDR20291_0105"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01645"
FT                   /db_xref="GOA:C9YHR4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR4"
FT                   /protein_id="CBE01645.1"
FT                   /translation="MLSKRLNFITPSYTIGISSKVKEMESNGVKVINLSIGEPDFNVPN
FT                   NAKSYGIDSLNKDYTKYDLVPGLKILREEICKKLIEENNCNYSIDEIVVSSGAKNSITN
FT                   TLLALTDEGDEVLLPKPYWVSYPEMIKLVNAVPVFIDTKKENGFKLTKEELEKSITDKT
FT                   KILVINNPSNPTGSVYTKDELIEIVDVCIQNKIYILADEIYEKICYTGEFTSIASLSEE
FT                   AKDITITINGFSKSAAMTGLRLGYTASNKTIAKAMSSIQGHLISHPSLTAQYIAYGALK
FT                   DCSIDIDNMVKTYKSRRDLIKSKLDSIDNVGYVNPNGAFYIFIDLSKVSEKFEYKDSFS
FT                   IEFCNQFLEEYNVAVVPGIAFGMDKYIRISYACSENTFLSGLDKLKEFVYKIMA"
FT   CDS             139825..142176
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="CDR20291_0106"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01646"
FT                   /db_xref="GOA:C9YHR5"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR5"
FT                   /protein_id="CBE01646.1"
FT                   /translation="MVEFVKKRDGRVIPFNEDRITRAIFLAATNVAEREGIVPDYKLSE
FT                   QLTQEVIKFLNHKYSESVPSVEDIQDSVVKVLIETGHAKTSEEYIIYRTERSRIRNSKT
FT                   RLMKAIEEITFEDAEDADIKRENANINGNTAMGTMLQYGSTVSKEFCKTHILKPEHSFA
FT                   HDNGDIHIHDMDFLNMGTLTCCQIDVKKLFNGGFSTGHGFLREPQDIISYGALAAIAIQ
FT                   SNQNDQHGGQSIPFFDYGLAEGVYKTFKKFYIGNLAKALKLFKGIENNDVIKNIVYNTE
FT                   KETNQKVGLKRDELYLNLEKEKLIQTFDIDDELVNKMQNFAFEESYRETDKKTYQSMEA
FT                   FIHNLNTMHSRAGAQVPFSSVNFGTDTSEEGRMVTKNLLLSQERGLGNGETPIFPILIF
FT                   KVKEGINLNPEDPNYDLFKLSCRVSAKRLFPNFSFLDAPFNAKYYKKGEPDTEATYMGC
FT                   RTRVLSNVCGSETVSGRGNISFTTVNLPRLGIKHGIINNEKANLDGFFEELDEKINLII
FT                   EQLLERFEVQGNKKMKNFPFLMGQGVWKGSDDLVPEDTLKEVIKQGTLTIGFIGLAECL
FT                   IALIGKHHGESKEAQELGLKIVSHMRHKMDEATDKYKLNFSLMGTPAEGLSGRFTKIDK
FT                   KVYGEIKGITDKEYYTNSFHVPVYYNISAYDKIEIEAPYHELTNAGHITYVELDGDPSD
FT                   NLEAFETVIKAMKDLGIGYGSINHPVDRDPICGFSGVITSNICPVCGRNEDESDIKFER
FT                   IRRITGYLVGTVDRFNNAKKAEVRDRVKHR"
FT   CDS             142198..142737
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="CDR20291_0107"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01648"
FT                   /db_xref="GOA:C9YHR6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR6"
FT                   /protein_id="CBE01648.1"
FT                   /translation="MKIRMSSTISYDSIVDGPGLRMVIWTQGCIHNCKECHNPQTHDLC
FT                   GGFYMDTEEIINKVKSLKLQKGITLSGGEPFLQPEPLEEIAREAKINGLDVWSYTGFTF
FT                   EQLLDKKNRAYFKNLNLLKQIDILVDGKFIAEKKDISLKFRGSSNQRIIDVQKSLKYKK
FT                   VFLVEQYMKDDLSIAE"
FT   gap             143507..143606
FT                   /estimated_length=unknown
FT   rRNA            144561..147513
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            147586..147702
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS             149443..150282
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0108"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01650"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR7"
FT                   /protein_id="CBE01650.1"
FT                   /translation="MLDINSFLNGFFNIILRMSIYDLIDISIVAYIFYKIFMFIKDTRA
FT                   EQVFKGIIFLLLATQLSNTFKLHTVYWISLKALDYGVIAALIIFQPEFRAGLEHIGRAK
FT                   FNLFGKNVNTSEETLNRNIEEIVEALYSLSRQKIGALIIMERETRISDIINTGTIIDAE
FT                   ISRQLLINIFIPNTPLHDGAVVIRDSKVKAAACFLPLTESKDLSKDLGTRHRAGIGVSE
FT                   VSDCITLIVSEETGGVSIAKAGKLYRDISRERMMNILRSNLKTNTETRSFFKGGIFK"
FT   CDS             150348..151460
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0109"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01652"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR8"
FT                   /protein_id="CBE01652.1"
FT                   /translation="MYVMAVVDPEETKGFEDIPVSISNMSDLKDKNLVIYPDEKLTADV
FT                   YIKGSLSKVQSVKKEDIHVYGTIEDPIQGQKEVYLKANIPQGVTLEFKHDVLVVNLEKN
FT                   IKEKRDIKVEVSGNSKRNINKIELSKEFVDVSGPRTLVKEVKSVRANLDVGNETDDFSK
FT                   KLQLIPLNSDGTKVEGVTLSSSFVTAKIELLKEKIVPIRVSLNDNKDNDVLKNYKLSKE
FT                   QVTIKGKKEDIDKISYIKTKPIDLADLANGEEKEVSLEIPEGITLEDSSITIKLNDTKQ
FT                   LSAEFLYNAGDIELRNIPTNIDNPNVISDVDIKVVVESTEDLSKLNKKDISLYIDLSQG
FT                   PEEDSKYKIKYETTYQFKKINIEPNIVEVE"
FT   CDS             151457..151576
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01653"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHR9"
FT                   /protein_id="CBE01653.1"
FT                   /translation="MNKYFEYLVVTRCDKKTYKIKFVNFMFLLHLVYFSYIIK"
FT   CDS             151749..152666
FT                   /transl_table=11
FT                   /gene="ptb"
FT                   /locus_tag="CDR20291_0111"
FT                   /product="phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01655"
FT                   /db_xref="GOA:C9YHS0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS0"
FT                   /protein_id="CBE01655.1"
FT                   /translation="MRWKCMRSFEEVIKFAKERGPKTISVACCQDKEVLMAVEMARKEK
FT                   IANAILVGDIEKTKEIAKSIDMDIENYELIDIKDLAEASLKSVELVSQGKADMVMKGLV
FT                   DTSIILKAVLNKEVGLRTGNVLSHVAVFDVEGYDRLFFVTDAAMNLAPDTNTKKQIIEN
FT                   ACTVAHSLDISEPKVAAICAKEKVNPKMKDTVEAKELEEMYERGEIKGCMVGGPFAIDN
FT                   AVSLEAAKHKGINHPVAGRADILLAPDIEGGNILYKALVFFSKSKNAGVIVGAKAPIIL
FT                   TSRADSEETKLNSIALGVLMAAKA"
FT   CDS             152688..153767
FT                   /transl_table=11
FT                   /gene="buk"
FT                   /locus_tag="CDR20291_0112"
FT                   /product="butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01657"
FT                   /db_xref="GOA:C9YHS1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS1"
FT                   /protein_id="CBE01657.1"
FT                   /translation="MSKIFKILTINPGSTSTKIAVFDNEDLVFEKTLRHSSEEIGKYEK
FT                   VSDQFEFRKQVIEEALKEGGVKTSELDAVVGRGGLLKPIKGGTYSVSAAMIEDLKVGVL
FT                   GEHASNLGGIIAKQIGEEVNVPSYIVDPVVVDELEDVARISGMPEISRASVVHALNQKA
FT                   IARRYAREINKKYEDINLIVAHMGGGVSVGAHKNGKIVDVANALDGEGPFSPERSGGLP
FT                   VGALVKMCFSGKYTQDEIKKKIKGNGGLVAYLNTNDAREVEERIEAGDEKAKLVYEAMA
FT                   YQISKEIGASAAVLKGDVKAILLTGGIAYSKMFTEMIADRVKFIADVKVYPGEDEMIAL
FT                   AQGGLRVLTGEEEAQVYDN"
FT   CDS             153826..154434
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0113"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01658"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS2"
FT                   /protein_id="CBE01658.1"
FT                   /translation="MNYVVKLRDMVSGKVAIADLDVVNVYFRTREKKELMKSLGIQPID
FT                   SSINAPTLDLPAVSAEVMSPMVDHSYNSVIDLGGDNVGARVIGRFSHLLKEGDYDMLFV
FT                   INANREKTQTSEEVIQYIKEIEKSSKLKVTGLINNTHLIRFTTIDDVLRGQKVAKEVSE
FT                   KCNIPIRYVACLENLVEQLPKDLEGEIFPIKLYMREDWM"
FT   CDS             154477..154692
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0114"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01660"
FT                   /db_xref="GOA:C9YHS3"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS3"
FT                   /protein_id="CBE01660.1"
FT                   /translation="MAKGKVSFNQERCKGCGLCVEACPVKIIQLDSNVINKKGYNPATV
FT                   FEMEKCIGCASCATMCPDVVITVERD"
FT   CDS             154721..155800
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0115"
FT                   /product="putative oxidoreductase, thiamine diP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01662"
FT                   /db_xref="GOA:C9YHS4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS4"
FT                   /protein_id="CBE01662.1"
FT                   /translation="MAKILMKGNEAFGKAAIEAGCKYFFGYPITPQSELPEYLSRELPK
FT                   IGGAFVQAESEVSAINMVYGGAGAGARVMTSSSSPGVALKQEGITYAVGAEVPCVVLNV
FT                   MRGGPGLGSIQPSQADYFMSTRGGGNGDYRTPVFAPATVQEAVDMIMEAFDVADYYRSP
FT                   VMVVADGMIGQMMEPVEFRAPEKKRELPPKDWATVGTKGKRKPNVINSLYLEPEVLEDH
FT                   CWHLQEKFDAMEKNEVQYEMYKTEDAEFVFAAYGTTSRVVKSAIDILREEGIKAGLIRP
FT                   KVLWPFPFEAFNQIPNARNILTVEMSMGQMVEDVKMAVEGKLPVYFHGRPGGMTPTPAE
FT                   IVEKAKKIIAGELVAGGAR"
FT   CDS             155800..156552
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0116"
FT                   /product="putative subunit of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01664"
FT                   /db_xref="GOA:C9YHS5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS5"
FT                   /protein_id="CBE01664.1"
FT                   /translation="MAVVFKKTEGLQDTQTHYCPGCTHGIIHRLVGEVLEELGVLGDAV
FT                   GVVPVGCSVLGYKYFNCDTQEAAHGRAPAAATGIKRVHPENTVFTYQGDGDLASIGTAE
FT                   IVHAAARGEKITTIFVNNTTYGMTGGQMAPTTLVGQRATTAQSGRNAETQGYPIRVSEM
FT                   LATLTGAVFVERVAVDTPAHVRQAKKAIKKAFQVQQAGLGFGIVEVLSTCPTNWGLAPN
FT                   DALQWLRDNMIPYYPLGNFKNVEVEEVK"
FT   CDS             156553..157110
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0117"
FT                   /product="putative subunit of oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01666"
FT                   /db_xref="GOA:C9YHS6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS6"
FT                   /protein_id="CBE01666.1"
FT                   /translation="MSTARVICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMR
FT                   GGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEKFKDDVIPGGKIIVNSSLIKEKV
FT                   DRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPRKEK
FT                   FVPLNREALQKGMDATCSKATN"
FT   CDS             157220..158626
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0118"
FT                   /product="phosphoglucomutase/phosphomannomutase mutase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01667"
FT                   /db_xref="GOA:C9YHS7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS7"
FT                   /protein_id="CBE01667.1"
FT                   /translation="MNYKNIIQITSFSIMKGESLVRKYFGTDGVRGVANTELTCDLAYK
FT                   LGRAGGFVLAQGDHRVKVVVGKDTRISGDMLEASLIAGLMSVGCDVITVGIIPTPAVAY
FT                   LTRKYGADCGVVISASHNPVEYNGIKFFNKNGYKLDDEIELKIEEYIDDIDKIDCLPIG
FT                   ENVGRKLHEHCAQRDYVDYLKSIISTDFKGLKVVLDCANGASYKVAPIVFDELGASVIS
FT                   INSSPDGNNINYKCGSTHPEQLQRAVLEHNADLGLAYDGDADRLIAVNEKGQIVDGDHI
FT                   MILSALNLKKNNKLAQDTLVVTVMSNIGLTIAAKENGINLSTTAVGDRYVLEDMVKNGY
FT                   NLGGEQSGHMIFLDYNTTGDGVLSSLILANIILQEKKPLSEIASIMSQYPQVLVNATIK
FT                   NENKNKYMEYPEIKTEIERIESILNGNGRVLIRPSGTEPLVRVMLEGKEEGQIKELATN
FT                   LANLIQEKLS"
FT   CDS             158893..160725
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="CDR20291_0119"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerising"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01669"
FT                   /db_xref="GOA:C9YHS8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS8"
FT                   /protein_id="CBE01669.1"
FT                   /translation="MCGIVGYLGSRKAAEVIVEGLSKLEYRGYDSAGVAVNSSNEEELN
FT                   IRKFKGRLSVLAEDLEKNPIDGNLGIGHTRWATHGEPSDVNSHPHFNQAKTIAVVHNGI
FT                   IENYMEIKEELISEGVKFESQTDTEVIAHLVDKYYEGNLLDAVYKTISKLRGAYALGVI
FT                   CKEHGNELVAVRKDSPLVVGVGEGENFIASDIPALLKYTRDVYFLENGEVVHLKDENVT
FT                   VYDSNRNLVEKEVFHVTWDVEAASKGGYDYFMSKEIHEQPTGVRETLERRLDDNGNIIL
FT                   DSINISKEDLEKINKVYIVACGTAYNAGLLGKYAIEKFVNIPVITDIASEFRYSDPFVD
FT                   ENSLVILVSQSGETADTLAVLRDSKAKGARILSITNVVGSSIARESDDVFYTWAGPEVA
FT                   VASTKAYTTQITSLYMIALDFAIKKGTITREFYDSMISKMKEIPSKIQEILDNEEYIKE
FT                   VAKTVVSSEHAFYLGRGIDYSLAMEGSLKLKEISYIHAEAFAAGELKHGTIALIEKGTP
FT                   VIAIATQEKLFEKMVSNMEEVRARGAYVVAIAQSHNKDVEKAADKIIYIPNSDDILSPI
FT                   LAVVPMQLLAYHVSVLRGCDVDKPRNLAKSVTVE"
FT   CDS             161178..162473
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0120"
FT                   /product="putative thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01670"
FT                   /db_xref="GOA:C9YHS9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHS9"
FT                   /protein_id="CBE01670.1"
FT                   /translation="MTNDFKKEKKEDYFVNLKAISTEVLQEKMQDNAWVIVDTRLNDAY
FT                   NGWKLDGVKRGGHIKRAVDFSANWLNVYSDRKDEVLEQALKTKRIDLDKNIVLYDANGK
FT                   DALVVADYLSKKGYKYLYKYDIKQWADDENLPMERYKNYQMIVPAFIIKDILDGKIPET
FT                   FEDSKNIKMIEASWGEESYTKGHIPTSVHVNTDIIEPPPTWMLDNDDNLTKFALDYGLT
FT                   KDDTVIVSSITPMASYRLAVILRYIGVKDVRVLNGGTNSWLSAGYELEFISNPKHSCTN
FT                   FGADIPVNSQLVVTTSELRQKLKEKNKFILVDNRTWDEHIGKVSGYTYYDKKGRIPGAL
FT                   YGHSGSNSVSLEEYRNIDNTMRNKSEILEMWDKENIDVNKQLIFMCGSGWRAAEVLTYA
FT                   NVIGVENTSLYSDGWMGWSLDNSNLIEVGEHK"
FT   CDS             162957..163694
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0121"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01672"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT0"
FT                   /protein_id="CBE01672.1"
FT                   /translation="MKKVKLAISFFILMIIGMTISYADTSINTRYNRLSKALEISEANF
FT                   KFYNVKINSVINHNLSNKEFHNIFIEIINNLKLDKKGINWNQKGSGDKIQLCATIKGSD
FT                   KEISIKGINKNNKESYIVVDILDNKVYKHKEVIYSNVENVLNKYSSQVDVSACIVGEYT
FT                   KRLQNNKYDDILQKILYNMSAKQIDEVKDVNFLSITAYSKVLNDYELEYLGEKINLNIG
FT                   IKYNEDDGKTLIYIATPIIKLDY"
FT   CDS             163697..164968
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="CDR20291_0122"
FT                   /product="UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01674"
FT                   /db_xref="GOA:C9YHT1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT1"
FT                   /protein_id="CBE01674.1"
FT                   /translation="MRRSKNMAKIIVKKSNPLKGSVKIDGAKNAVLPIIAATLLANGKS
FT                   TLNGVPNLRDVHVISDLLRHVGAEVEYKENTLTVDASNIKTCEAPYELVRKMRASFLVM
FT                   GPLLARFNSTKISMPGGCAIGTRPIDLHLKGFKALGAKIEMDHGFVEAATEKLVGNKLY
FT                   LDFPSVGATENIMMAASLAEGTTIIENAAEEPEIVDLANFLNEMGADVKGAGTNTIKIK
FT                   GVKELKGAEHNVIPDRIEAATYMVAAAMTKGDITVENVLMEHLKPVVAKLREAGCEITE
FT                   MDNSVRVVGPKVLKPIDIKTLPHPGFPTDVQAQFMAMLTVANGTGVVIETVFENRFMHV
FT                   AEFNRMGANIKIDGRSAVVNGVDELHGAAVNATDLRAGAALILCGLIAEGETQIGEIYH
FT                   IQRGYVDIDKKITALGGQIEIVED"
FT   CDS             165055..166119
FT                   /transl_table=11
FT                   /gene="spoIIC"
FT                   /locus_tag="CDR20291_0123"
FT                   /product="stage II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01676"
FT                   /db_xref="GOA:C9YHT2"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT2"
FT                   /protein_id="CBE01676.1"
FT                   /translation="MKNPLVVLLGFVTCSVLVPSLITLVSYKNVELTEKPESPVSINKT
FT                   IKKSDIEDKGNKEEKSTVSYETVNKKAPIINVYNHITGKTEKMDMENYLCGVLAGEMSS
FT                   EFDIEALKAQSVAARTYVVYKQEHGKSSKHKNAVVCTDYKHCQEYKSYDTLKKLNGEEW
FT                   IKNKYSKIQEAVRGTKGQIITYNDKAILPLYFSTSSGKTENSEEVFSAKYPYLKSVESP
FT                   YDKYSPKFASTLKISNTDFVKSLRRAYSTIVIDVNNLSKQVSITKRSDAGTVEKIKLGN
FT                   KELTGKDIRTVFKLNSANFDIKFGEGYIDFVVKGYGHGVGMSQWGAEGMAEEGYKYYDI
FT                   LSHYYTDTKIKDIY"
FT   CDS             166185..166853
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0124"
FT                   /product="putative cell wall endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01677"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT3"
FT                   /protein_id="CBE01677.1"
FT                   /translation="MKKKLLEKDGFYLSLFVCVCLLAVGGVWFTNNNVDKLASNKGIME
FT                   NANKDSEEEIHLIEKDKKDAIPTATDSKQNLEKAKSKEENKSSTTKLNYIGDKVIRGYS
FT                   EKEPSYSKTLDVWETHKGVDISCTKGKEVKSLLNGIVVDVFNDEEYGQSVKIKSDNNIV
FT                   VVYSNLDKNVSVKKEQKVTEGQSLGTVGSTSQIESEEGIHVHLEAYSGEKSIDPMSLIK
FT                   "
FT   CDS             166951..167211
FT                   /transl_table=11
FT                   /gene="spoIIID"
FT                   /locus_tag="CDR20291_0125"
FT                   /product="stage III sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01680"
FT                   /db_xref="GOA:C9YHT4"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT4"
FT                   /protein_id="CBE01680.1"
FT                   /translation="MRSHIEERAIVVAKYILEKNTTVRQTAKTFGVSKSTIHKDVTERL
FT                   KEINPSLAKEVKNVLDKNKSERHIRGGLATKLKYEKEHKKM"
FT   CDS             167408..168427
FT                   /transl_table=11
FT                   /gene="mreB1"
FT                   /locus_tag="CDR20291_0126"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01681"
FT                   /db_xref="GOA:C9YHT5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT5"
FT                   /protein_id="CBE01681.1"
FT                   /translation="MAGADIGIDLGTANVLVYVSGKGIVLEEPSVVAIDKRTDSVLAVG
FT                   EEAKKMIGRTPGNIVAIRPLRDGVISDYDVTEKMLKSFIDKIVDKKGFGRFFMPRIMVC
FT                   VPTGVTEVEKRAVEDATRQAGAREVYIIEEPIAAAIGAGVDISQPNGNMIIDIGGGTVD
FT                   IAVISLGGAVVSESIKVGGDRFDDAIVKYMKKQHNLLIGERTAEKIKFEIGSAFKREEE
FT                   KYMKITGRNLITGLPSSITINSTEMLEALRECVEQIVVATHAVLEKTPPELAADIGDVG
FT                   IIMTGGGSLLYGLDKIIEQRTGITVTIADEPLSCVAKGTGIALGSIDLLETGGSFKRK"
FT   CDS             168443..168871
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="CDR20291_0127"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01683"
FT                   /db_xref="GOA:C9YHT6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT6"
FT                   /protein_id="CBE01683.1"
FT                   /translation="MLNIDEIKKLIPHRYPFLLVDKITELEVGKRAVGIKNVTVNEPFF
FT                   QGHFPEYPLMPGVLIVEALAQVCGVAMMSVEENKGKLGVFAGIDKVRIKREVRPGDTLT
FT                   MEIEMTTLRKNIAKADAKAYVGEELVCKGELMFALVEK"
FT   CDS             complement(168982..169500)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01684"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT7"
FT                   /protein_id="CBE01684.1"
FT                   /translation="MFLLYLAKVNYSDDDVIQMLSSVLKTIINENTIVVCIGTDRAIGD
FT                   TLGPLVGTILKNSNFKYPVYGTLDNPIHALNIYESLDTIKNTHIQGNFLAIDACLGSQS
FT                   NIGNIQIREGPILPGKGVGKKLPQIGNYSIVGIVDKIDENNKLSFNNIRLSFILDLAET
FT                   IALALLVST"
FT   CDS             169920..171113
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="CDR20291_0129"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01686"
FT                   /db_xref="GOA:C9YHT8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT8"
FT                   /protein_id="CBE01686.1"
FT                   /translation="MARHLFTSESVTEGHPDKICDQISDSILDALLEKDPQSRVACETT
FT                   VTTGLVLVAGEISTSAYVDIPKLVRETVREIGYTRAKYGFDCDTCAVITSIDEQSGDIA
FT                   MGVDEGLESKTGEEIEEEIEKVGAGDQGIMFGFACNETPELMPLPISLAHKLSRRLTEV
FT                   RKTGLVDYLRPDGKTQVTVEYEGSKAVRVHTVLISAQHCETVSNDKIREDLINHVIKEV
FT                   IPAELLDEETKIYINPTGRFVIGGPQGDTGLTGRKIIIDTYGGYSRHGGGAFSGKDPTK
FT                   VDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGIARPLSIFIDTFGTGKVSEEKLVEL
FT                   VNKHFDLRPGAIIRDLDLRKPLYKKVAAYGHFGRTDIDLPWERTDKVEQLRKDALGE"
FT   CDS             171429..172526
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0130"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01688"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHT9"
FT                   /protein_id="CBE01688.1"
FT                   /translation="MSGKVNIKTVISFAGAYVATVIGSGFATGQEILQFFTFYGYAGII
FT                   GGIISMVLFSWFGAEVIDKGRELKLKEPIKIYQVYCGKYLGTFFEWFGPLFLFGTLVIM
FT                   IAGAGATLSEYYGLNPYVGRIGMAIVSLITVSLGLTRLSKILGNIGPIIIIFTLLVGAI
FT                   SLFSNIDALSNAGNMVDSLNIKTATSNGYFSGVLYTCYNVIIVITFLTGMGASAVNKKD
FT                   AVWGGIVGGVALMAAAIMMNLALLSNIGNIYTKEIPALYLADKISPIIGILFSVVLLLG
FT                   IYTTAVPLLWSVTNRFVEDDHPKFKIITIVVSILACIGGLLPFDKLVGTLYPYTGYMGI
FT                   LILLCMLYRRITKTEGYKENKSEIS"
FT   CDS             172790..175009
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0131"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01690"
FT                   /db_xref="GOA:C9YHU0"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU0"
FT                   /protein_id="CBE01690.1"
FT                   /translation="MEKLEGMISEIVFKNEDNGYTIAHLVNENDEIVVVGCMPTLAIGE
FT                   SIEVEGKWVNHKIYGTQFEVNSFMPVTPSSLEGIYVYLSSGMIHGIGEKMAKRIIDKFG
FT                   VDTLEVIQNSPEKLQEVEGIGSKKVKQIVKSYEEDRELRNIIIQLSPFGITPNYCLKIY
FT                   KKYKSSAIEVINKNPYQLAEDIRGIGFKVADSIASKIGIDKNSKDRICQGILYTLNKSL
FT                   SNGHTYLPEHVLIQDSEKLLELNGEIIKECVMMLVYNQKIHIEKVNNENLIYLMPYYLA
FT                   ENGVCSQIVKLSQYEFEDLKIDIDNEINVLEEDKKIKLAEKQILAVKESVNSGVLIITG
FT                   GPGTGKTTTINAIIDIFENNGKSVTLAAPTGRAAKRMSETSNKEAKTIHRLLEMGFSTD
FT                   DDLTFFKDEEDPINSDVIIVDEVSMVDIILMYNLLRAIKLGTRVILVGDSDQLPSVGAG
FT                   NVLKDMINSNIINVVKLNEIFRQAQESMIIVNAHKINNGEPLYLNTKGKDFFFIRKSTN
FT                   EEILNEIIGLVNERLPKFYKVDKLKDIQVLSSMRKGELGVTNLNIELQKYLNKKEKFKV
FT                   EESFSKRLFRVGDKVMQVKNNYTKKWETEDQKESGEGIYNGDIGYVYHIDKDKKTIYIL
FT                   FDQTKIVSYLYDELDEIDHSFCTTIHKSQGSEFPVVVLPIAWAPPMLLSRNLLYTAVTR
FT                   AKKLVVLVGDVKYLEYMIKNNRVNQRYSNLGYKLNKFKQEGLLIE"
FT   CDS             175012..175794
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0132"
FT                   /product="putative phosphoribosyl transferase (putative
FT                   competence protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01691"
FT                   /db_xref="GOA:C9YHU1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU1"
FT                   /protein_id="CBE01691.1"
FT                   /translation="MKICNDNFIKNFKNMINKCLDFIYPENISCIICDKSIKKTNTYSI
FT                   CKSCFKEMNFIQDGCMKCGKPIIRHSIEKEFIEECSYCFNKDFYFDKSISCIEYNDVTK
FT                   KMVLGLKYNQKTFMAKYIAQIMKEKLYLENIKFDYILFVPLHKKRLNKRGFNQAQKIAF
FT                   NLSKIVNIPLLDCISRKKYTRMLYKLNKKERKEELKNVFVVKENVKLINNKNILLIDDI
FT                   FTTGLTTNEISKLLKLSGANKVFVLTLLTKANDNYIME"
FT   CDS             176126..178039
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0133"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01693"
FT                   /db_xref="GOA:C9YHU2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU2"
FT                   /protein_id="CBE01693.1"
FT                   /translation="MICLNKRQENLLTTLLLKEEFINVNKIANDFECSERTIRNDCKYI
FT                   DEWLSTFCNAYIKRKPNIGIKFSGDGTDKILVNQKLRGEVKRVNSELHKQVEILNLLLC
FT                   NNKKVTLNDLSNKLYINKNIVREEISKLSVALNNYNLNVSTKKGSGIYIEGDEKDIRIM
FT                   LVSFLFKYIDKYRLNIDEIEYFHIVDIIIVKNIMLTIEEDMDIRLTDISFKQLMLFLLI
FT                   NIIRIRLGNSLKVSNTKKELKLKMLILDIEDELKSNLSIVLNYEEKLFIESLILGMNKQ
FT                   INSNNIKKSLYLNEELASYTKKIINLVSEESGINFNNDILLYEQLICHLNVTMHQMKSN
FT                   VYLENPLLDNIKTKFCFLFTVISSSIEIELKGKQITEDEIGYLTLHFQTSLERKYSKRE
FT                   SNKKASIVCPFSFGVSMLLKVKIEKRFDNIKIIETLREEDLKRDNFNKTIDFIIAFQEY
FT                   ENIQKPIFITTPLFTDEDENKLKEFTNKIKEKDTSYKLMNRLMMSDYLIRELEHDDIYE
FT                   AITYLTNLLIEKHYAEKEYLQSIITREKSYPTNVGKGILFPHGDMKYIKQSVLCFARLK
FT                   TPIKIRNGKDIKIILLLAYKKDDDRKVFRELFKEISNLTEDENMLDILSKCDIEKVKDI
FT                   LI"
FT   CDS             178180..178488
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0134"
FT                   /product="PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01695"
FT                   /db_xref="GOA:C9YHU3"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU3"
FT                   /protein_id="CBE01695.1"
FT                   /translation="MEEIVLKIIIHAGNAKSMLYEALDYAKENDFKKADELIENANEEI
FT                   LKAHKVQTELIQKEAGGDKSDISILLIHSQDHLMTCMSERNLIKEMIMLRKEIQKLK"
FT   CDS             178513..178839
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0135"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01697"
FT                   /db_xref="GOA:C9YHU4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU4"
FT                   /protein_id="CBE01697.1"
FT                   /translation="MKRKVYLFCSFGMSTSLLADKMQKVADEHNLPIEVEAFPIAEIDK
FT                   IVEEKNPDCILLGPQVKYMLKELKPKFEAQGKLIDIINEVDYGTMNGEKVLKLAIKLIK
FT                   SKQA"
FT   CDS             178878..180212
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0136"
FT                   /product="PTS system, IIc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01698"
FT                   /db_xref="GOA:C9YHU5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU5"
FT                   /protein_id="CBE01698.1"
FT                   /translation="MNRLERILMPLAEKIGKNKLLIAIRDGFLISSPLLIIGSLFLLVA
FT                   NFPIKGWNEFVGQIFGPDWAVKLQQPTVATFEVMTLLAVLGIGYSYAKQIDVDPIASAA
FT                   VAIVAFFIVTPFVIPYTPEGTESVYMVTGIPLGWMGSKGMFVGMITAITSVKLFAAVVK
FT                   KGWTLKMPDGVPPTVSKSFAALIPSAIVMVVFFLVKIAFEATPYGSIHEFIFKFLQMPL
FT                   LKLGNSLGAMAIAYIFLHLFWFFGINGSSVVGAVYNPILKILSAENLAAFQAGSKIPNI
FT                   ITGQFQDMFATFGGAGSTLSLVIAMLLICKSKRIKSMGKLSILPGIFGINEPLIFGLPI
FT                   MLNPILLIPFAIVPTINIIIAYFCMSAGLVPLTNGVQLPWTTPIIFSGFLTTGWQGAVL
FT                   QLVLLILGIFMYIPFIKMLDKQYLREENETVEEEDDDISFDDLVL"
FT   CDS             180223..180741
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01700"
FT                   /db_xref="GOA:C9YHU6"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="InterPro:IPR022787"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU6"
FT                   /protein_id="CBE01700.1"
FT                   /translation="MKKIVMILDQIQAGAGGKEKSNIPPAGKSSPLGPGVMMEQFLNES
FT                   KVIATLFCGDEFFVNNEKEVTSKMIAMVKKLNPDVVICGPSFNYENFSKMSAILSKNIN
FT                   DKTDIPAFAAMSEENIDVINEYKNDICIVKTPKKGGIGLNDSLNNICKLAKAIANKEDI
FT                   TLMKEEFCY"
FT   CDS             180837..181796
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0138"
FT                   /product="glycosylasparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01702"
FT                   /db_xref="GOA:C9YHU7"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU7"
FT                   /protein_id="CBE01702.1"
FT                   /translation="MWGMIATWRMALEGITEASEHLEKGMEAGDAVELAVRRVEDYPFY
FT                   KSVGYGGLPNENCEVELDAAFMDGNTLDIGAVAGIRDYSNPVSIARKLSYEKVNNFLVG
FT                   IGAEDYAHKNGFERKNMLTDRAKLHYKKRKKETLDKGLSPYAGHDTVGMISLDKTGKMC
FT                   AATSTSGLFMKKRGRIGDSALSGSGFYVDSSIGGATATGLGEDLMKGCISYEIVRLMKE
FT                   GKHPQEACDIAVNELDKQLIKRRGKAGDLSLVAMNNKGEWGVATNIVDFTFSVVTKEES
FT                   PAVYISNRVDGKTIHKVISNEWMEAYEARIKAPIEVSE"
FT   CDS             181844..182896
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0139"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01704"
FT                   /db_xref="GOA:C9YHU8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU8"
FT                   /protein_id="CBE01704.1"
FT                   /translation="MNIISNKIDELKEDLLSDIIDIVKIPSVKGESENGFPFGEKVGEA
FT                   LNKALEISKKLGFKVRNLDNYIGYAEHGDSDDYVCVIGHVDVVHEGDGWKHQPYKGEET
FT                   NGRIYGRGVLDNKGPIMSALYGLYAIKELNLKLDKRVRIIFGTNEESGFEDIPYYLEKE
FT                   KTPIMGFTPDCKYPVVYGEKGMAKIRIKSKINYEEDVYLGFIENMSENVLVTYKELNIE
FT                   NSNTILDIKVKYDFSYKLKDVLDEIKASFPNSIDIEVISNFNPVYFDKESNLVKKLQLA
FT                   YERVTSLDGTPVTTNGGTYAKVMPNIVPFGPSFPGQKGIAHNPDEYMDIEDIILNAKIF
FT                   ANAIYELAKE"
FT   CDS             182899..183573
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0140"
FT                   /product="putative copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01705"
FT                   /db_xref="GOA:C9YHU9"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHU9"
FT                   /protein_id="CBE01705.1"
FT                   /translation="MLEIIGMSVEDAKIIEDCGADRIELVSALTEGGLTPSFGLIESVV
FT                   NSVKIPVNVMIRHHAKSFVYSKEDISIMQKDIGVVKEIGANGVVFGVLDKNNNIDEKNL
FT                   NVLLKCCDNLDVTFHRAIDESNTIDSVKILKDYDKITNILTSGGKGSIVDNIQMIKNMM
FT                   LSSNHIKILLGGGLNFNNIEKIKELTKASNFHFGTAIRINNSPFEDIDRQKLKQLVNII
FT                   SR"
FT   CDS             184126..184677
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0141"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01707"
FT                   /db_xref="GOA:C9YHV0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV0"
FT                   /protein_id="CBE01707.1"
FT                   /translation="MNIIISGKQIELTDAIKNKIETKLSKLDNYIHPDTDVKVTVSARK
FT                   ARQKIEVTIATVNGPIIRAEDMQENLYTAIDVVYDKLSKQLKKYKKRLQDKHKDNKSIR
FT                   FQDSEINLADEQEDYGDENQELVIQRRKKFSVKPMSEEEAVLQMELIGHDFYMFKNIDS
FT                   DEIAVVYKRNNGGYGIIEHE"
FT   CDS             184809..187484
FT                   /transl_table=11
FT                   /gene="secA1"
FT                   /locus_tag="CDR20291_0142"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01709"
FT                   /db_xref="GOA:C9YHV1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV1"
FT                   /protein_id="CBE01709.1"
FT                   /translation="MSFMDNLFNMADKKELKKFNKTVDIIDSLEPKFESMADSELKNMT
FT                   NIFKERLANGESIDDILPEAFAVVREVSKRVLGLRHYRVQMIGGIVLHQGRIAEMKTGE
FT                   GKTLVATAPVYLNALTGKGVHVVTVNDYLAKRDRDQMAKIYEFLGMSVGVIIHGQNPKV
FT                   RKEQYDCDITYGTNNEYGFDYLKDNMVIHKEQRVQRGLNYAIVDEVDSILIDEARTPLI
FT                   ISGPGDKSTHLYSDANTFVLTLKPDDYELEEKDKAVSLTASGIQKAEVYFNVDNITDIS
FT                   HTELYHHINQALRAHVIMKKDVDYVAKDGEIVIVDEFTGRLMFGRRYSEGLHQAIEAKE
FT                   GLKIQRESKTLATVTFQNYFRMYKKLSGMTGTAKTEEEEFKAIYKMDVFQVPTNKLMVR
FT                   EDLPDSVYKSEIGKFNAVAQEIIERHKVNQPILVGTVSIEKSELLSQILKKKGIKHEVL
FT                   NAKHHDKEAEIIAQAGRLGAVTIATNMAGRGTDIVLGGNPDFLTKREMRRNGFKEEIVN
FT                   RVDTPIEGIPVKGNEILFEAREEYEKLFEKFKQQTQEEQKQVVEAGGLAIIGTERHESR
FT                   RIDNQLRGRAGRQGDPGSSRFYIGLDDDLMRLFGSDRISGIVDKIGLEEDMPIEHRILS
FT                   KSIEGAQKKVEGKNFGIRKHVLQYDDVMNKQREIIYAERKRVLEGEDLQEQIQSMTHSI
FT                   IEEAVTLYTQDKGFDEEGFKEHMYNLFLPKGSIEIPEIEKLNPVEITEKVYEIAMKIYT
FT                   SKEEQVGYERMREVERVILLQAVDNHWIDHIDAMDQLRQGIGLRAVGQQDPVIAYKMEG
FT                   FDMFDEMNKHIKEDTVRYLFNITIETPVERKAVVDVENLSSPSDGTLPTSKTVKKDEKV
FT                   GRNDLCPCGSGKKYKNCCGR"
FT   CDS             187590..188606
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="CDR20291_0143"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01711"
FT                   /db_xref="GOA:C9YHV2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV2"
FT                   /protein_id="CBE01711.1"
FT                   /translation="MKNIQINEEKMNQQDFWNDNEVAQRVLQENKSLKETLEEYESLKS
FT                   LLEDIEVLIEIGLEEDDDSVERDIEKSIESMEEKLSEMKIKTLLNGEYDKNNAILSINA
FT                   GTGGLDAQDWAQMLLRMYIRWSESKGYKVKLLDIISDPEAGIKTATILVEGTNAYGYLK
FT                   SEKGVHRLVRISPFDPSGKRHTSFASIDVTPELDENIEVEINPSDLKIDTYRASGAGGQ
FT                   HVNTTDSAVRITHIPTGVVVQCQNERSQHLNKDRAMRLLMAKLIELKELEQKEKIEDIQ
FT                   GKYSQITWGSQIRSYVFQPYKLVKDHRTNAEFGNVDSVMNGNIDLFINEYLKMNKIV"
FT   CDS             188741..190891
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0144"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01713"
FT                   /db_xref="GOA:C9YHV3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV3"
FT                   /protein_id="CBE01713.1"
FT                   /translation="MNKLDINQILKKEFNLRDEQINNTLKLIDEGNTIPFIARYRKEMT
FT                   GEMSDVTLREFYEKLMYLRNLQSRKDDVVRLIDEQGKLTDEITQNIEKAKTLQEVEDIY
FT                   APYKQKKRTRATIAKEKGLENLALSILENNLDNIEIEAKNYLDEEKEVLSIEDALKGAR
FT                   DIIAELVSDDAKIRKYIRELALREGMIVSKSATDEKSVYDMYYDYNEAVKSMAPHRVLA
FT                   INRGEKESFLKVKLEINNDKVLNYIINEYVNDKNFKNKEEIVSSIEDSYKRLIFPSIER
FT                   EIRNHLTEIAQERAISVFGKNVKSLLLQPPVKDKVVMGFDPAFRTGCKIAVVDKNGKLL
FT                   DYTTVYPTDPQNDVEGAKKVLKGLIEKYDIDIISIGNGTASRESETFVSEMIKEIDSEV
FT                   QYVIVSEAGASVYSASELANEEHPDINVSIRGAISIARRLQDPLAELVKIDPKSIGVGQ
FT                   YQHDLNKKRLEEVLDGVVEDSVNSVGVDLNTASYSLLEHVAGISKAIAKNIIAYREENG
FT                   DFTSRAQLKKVKRLGPQAFTQCAGFMRILEGKNPLDNTGVHPESYDICKKMIEIIGYSL
FT                   DDVKNKNIGEIDEKIKEIGLRELSEKLEVGQVTLKDIIAEIKKPGRDPREEGIKPILRT
FT                   DVLKIEDIQEGMTLKGTIRNVVDFGAFVDIGIKNDGLVHKSEMSNSFVKDPMSIVTVGD
FT                   IVDVKVIGIDLNKKRVALSMKK"
FT   CDS             191039..192205
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0145"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01714"
FT                   /db_xref="GOA:C9YHV4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV4"
FT                   /protein_id="CBE01714.1"
FT                   /translation="MIFIKNGKINTITNGIIHGDILIDEGKIIEIGEDLIAPLDVEVID
FT                   ASNKLVFPGFIDAHTHLGLWEDGIGFEGADGNEETDPITPQLNPIDGINPMDRTFKEAF
FT                   EGGITSVCTTPGSANVMGGQCIAIKTCGKRIDKMVIKNPVASKIAFGENPKSCYGQDDK
FT                   SPQTRMAIAALLRENLKKAEEYLEDIDMYESHDDEDCEKPEYDIKMESLIPVLRREIPF
FT                   KAHAHRADDMFTAIRIAKEFNLKLTLDHCTEGHLIVDELVEEGFPVIVGPSLSERSKFE
FT                   LRNLTFNTAGILSNAGLDVCIMTDHPVIPVQYLPICAGIAVKHGMKEEKAIESITINPA
FT                   KTLGIEDRVGSIEVGKDADLVIWDNSPLEIQSNVLYTIINGKVVYEKK"
FT   CDS             192507..193112
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0146"
FT                   /product="putative riboflavin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01716"
FT                   /db_xref="GOA:C9YHV5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV5"
FT                   /protein_id="CBE01716.1"
FT                   /translation="MQNTAKRGNMISTRTLVVMSILSAISYLLMFIQAPIPGIFPDFLK
FT                   IDLSDIPAIFGGMSLGPLVGFGIVVVKNVLQAITATTTGGIGEFANILIGGSYVMILCY
FT                   SYKRSGDLKGVLIGFVLGTISMTIIGSLVNYFVMLPLYGQLMGLDAIIGLGSAINPQVH
FT                   DLFTFVIWMIAPFNVLKAVIISLVTLPLYKKMGNIIKK"
FT   CDS             193441..194481
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01718"
FT                   /db_xref="InterPro:IPR025197"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV6"
FT                   /protein_id="CBE01718.1"
FT                   /translation="MHLSKKIKKLFLDDKGYYFNSNWEDIHIGIYDTKLGDSLKYITNE
FT                   YIENMERVKYDYRELKNIENQTDGMCILAIRQNYKALEYVKNQTEELCLEAIKYNYKAL
FT                   EYVKEQTEYLCLEAIKKDCNALKYVRNKTEGLIIKAISHSSNIDVVSILKALETQTRRI
FT                   CLEAIKKDGRCLAYVREQSEELCIEAIKQNYKALKYVKNQTEKMCIESVRQNGMALQYV
FT                   NKQTDKICIEAVKQDGRSLQFVNNKTEEICINAIRYLNKKYNIKDVLSYIDKYTEDICI
FT                   EIVRQNGKMLMYIKNQTEKMCIEAVKENYKSLKYVKEQSERICKEALKQNHKAKEYVKI
FT                   AIDDCI"
FT   CDS             194620..195072
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0148"
FT                   /product="putative ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01720"
FT                   /db_xref="GOA:C9YHV7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV7"
FT                   /protein_id="CBE01720.1"
FT                   /translation="MAKIYLENENKTREIGYKLGKLLKEGSVICLVGDLGAGKTTMTQS
FT                   LADSLGIEDYITSPTFTIINEYEGKIPLYHFDVYRIGSSDEMYDIGYDEYVNSNGICII
FT                   EWANLIEDILPKEYLNIELRYKDEGREMILTPKGEFYKEIVEELIK"
FT   CDS             195087..195788
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0149"
FT                   /product="putative glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01721"
FT                   /db_xref="GOA:C9YHV8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV8"
FT                   /protein_id="CBE01721.1"
FT                   /translation="MDTSSMAASVAVVEDDNLICEFTVNNKKTHSQKLMPMIENMLSMS
FT                   DLSIKDMDLLAVCIGPGSFTGLRIGMATVKAMAHVNNIPIIAVNSLESLANNINFCDRK
FT                   ICCILDAQKNQVYSAKYKFENGEMIELDGVDVVEFDALVDEIVSTNEEFIIVGEAVYKY
FT                   KDKLENIKNIKIPSPANNVSNAGSLCSLALNKYNKNIDVHTCYTINPMYIRKSQAEVQY
FT                   DEKMKRLNNGR"
FT   CDS             195826..196254
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="CDR20291_0150"
FT                   /product="putative ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01723"
FT                   /db_xref="GOA:C9YHV9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHV9"
FT                   /protein_id="CBE01723.1"
FT                   /translation="MTTEDIDEVFEVEKNCFEDYWSKESFRKELSNEVARYIVAKLNGK
FT                   IVGYVGIWLILDEGHINNVAVHSDYRGKKIGDKLIKCIVDLCKDNNIASMTLEVRASNK
FT                   IAQNLYRKYGFKMGGIRKEYYSDNKEDAIIMWNQLKEV"
FT   CDS             196260..197276
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="CDR20291_0151"
FT                   /product="probable glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01724"
FT                   /db_xref="GOA:C9YHW0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW0"
FT                   /protein_id="CBE01724.1"
FT                   /translation="MSDIITLAIESSCDETAASVLKNGREVLSNIISTQIETHKKFGGV
FT                   VPEVASRKHVENIDIVVQEALDKANIGFNDIDHIAVTYGPGLVGALLVGLSYAKALAYT
FT                   LNIPLVGVNHIEGHLSANYIEHKDLKPPFITLIVSGGHTHLVEVKDYGKYEILGKTRDD
FT                   ASGEAFDKISRAMNLGYPGGPIIDNLAKNGNKHAIEFPRAYLEEDSYDFSFSGLKSSVL
FT                   NYLNGKRMKNEEIVVEDVAASFQEAVVEVLSNKALKAVKDKGYNIITLSGGVASNSGLR
FT                   AKITELAKDNGITVKYPPLILCTDNAAMIGCAGYYNFINGKTHDMSLNAVPNLKINQ"
FT   CDS             197573..200281
FT                   /transl_table=11
FT                   /gene="hpdB"
FT                   /locus_tag="CDR20291_0152"
FT                   /product="4-hydroxyphenylacetate decarboxylase, catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01726"
FT                   /db_xref="GOA:C9YHW1"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9YHW1"
FT                   /protein_id="CBE01726.1"
FT                   /translation="MSQSKEDKIRSILEAKNIKSNFQNKENLSEFNEKKASKRAEDLLD
FT                   VYYNTLSTADMEFPYWYNREYRKSDGDIPVVRRAKALKAAFSHMTPNIIPGEKIVMQKT
FT                   RHYRGSFPMPWVSESFFVAQGEQMREEAKKLASNTADELTKFGSGGGNVTESFGNVVSI
FT                   AGKFGMRKEEVPVLVKMAKEWVGKSVEDLGFHYEKMMPDYDLKENLMSTLICMFDSGYT
FT                   LPQGREVINYFYPLNYGLDGIIEMAKECKKAVAGNASGDGLIGMDRLYFYEAVIQVIEG
FT                   LQTWILNYAKHAKYLESIETDLEAKKEYSDLVEILEHIAHKQPRTFREALQLTYTIHIA
FT                   SVNEDAISGMSIGRFGQILYPWYEQDIEKGLITKEEVIELLELYRIKITCIDCFASAGV
FT                   NGGVLSGNTFNTLSIGGLKEDGSTGANELEELLLEASMRCRTPQPSLTMLYDEKLPEDF
FT                   LMKAAECTKLGSGYPAWVNNSNGTTFMMKQFADEGMTVEEARAFALGGCLETSPGCWKQ
FT                   LTLNGKTYSIAGGAGQSAGSGVHFIANPKILELVLMNGKDHRMNIQVFEPHNKPLDTYE
FT                   EVIEVFKDYYKQAINVLERANNIELDIWRKFDTSIINSLLKPDCLDKGQHIGNMGYRYN
FT                   ATLNVETCGTVTMVNSFAALKKLVYDDKAFTIEEMKDAILNNFGFKDALEVGNYSMADQ
FT                   VKVDKTGKYDAIYKACLDAPKYGNNDLYADNILKNYEVWLSKVCEEAQSLYAKKMYPCQ
FT                   ISVSTHGPQGAATLATPDGRLSGTTYSDGSVSAYAGTDKNGVYALFESATIWDQAVVQN
FT                   SQMNLKLHPTTIKGQQGTKKLLDLTRSYLRKGGFHIQYNVVDSETLKDAQKNPDNYRQL
FT                   MVRVAGFTQYWCELGKPIQDEVIARTEYEGV"
FT   CDS             200285..200542
FT                   /transl_table=11
FT                   /gene="hpdC"
FT                   /locus_tag="CDR20291_0153"
FT                   /product="4-hydroxyphenylacetate decarboxylase, regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01728"
FT                   /db_xref="GOA:C9YHW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9YHW2"
FT                   /protein_id="CBE01728.1"
FT                   /translation="MRKHSDCMNFCAVDATKGICRLSKQMINLDDSACPEIKVMPKCKN
FT                   CKNFVEANDEGIGKCVGLEKEDWVYSTLNAITCEGHVFNE"
FT   CDS             200505..201485
FT                   /transl_table=11
FT                   /gene="hpdA"
FT                   /locus_tag="CDR20291_0154"
FT                   /product="4-hydroxyphenylacetate decarboxylase, activating
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01729"
FT                   /db_xref="GOA:C9YHW3"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9YHW3"
FT                   /protein_id="CBE01729.1"
FT                   /translation="MQLLVKDMCLMSSQKQLEGMIFDVQSFSVHDGPGCRTTVFLNGCP
FT                   LSCKWCANPESWTVRPHMMFSELSCQYENGCTVCHGKCKNGALSFNLDNKPVIDWNICK
FT                   DCESFECVNSCYYNAFKLCAKPYTVDELVQVIKRDSNNWRSNGGVTFSGGEPLLQHEFL
FT                   HEVLLKCHEVNIHTAIETSACVSNEVFNKIFKDIDFAFIDIKHMDREKHKEQTGVYNDL
FT                   ILENISNLANSDWNGRLVLRVPVISGFNDSAENISDIISFMHKNNLIEINLLPFHRLGE
FT                   SKWIQLGKEYEYSDKGDIDEEHLEELQDIFLDNGIACYVGHETAF"
FT   CDS             201805..202767
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0155"
FT                   /product="putative membrane-associated CAAX amino terminal
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01731"
FT                   /db_xref="GOA:C9YHW4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW4"
FT                   /protein_id="CBE01731.1"
FT                   /translation="MNKSWSNLIIKNKDKKVRSGWIIITVMAAFYIFEYYLSTILMEII
FT                   RKILIATGDINLKTNYFSEYANWLNDVGLQVVFQILTDSLMIIIPIIVWRFIMKNPISE
FT                   MGLHSYRIKKKEGYVGMLLGIFNCTVIFIITITIGGGHVTSWVPKISPLTVSWILVFIL
FT                   VAFAEEILNRGFFMAVLRRCKNIYFIMIVPSVIFGLIHIWNPDVTFLSVINIIIIGILF
FT                   SYMFIKSSNIWMCIGYHFTWNVFQGIIYGMPVSGLQVPGIITTQITHGNLLNGGMFGIE
FT                   GGILTTFVNLLSFIFVWYYYRDSKYDFVSDKVNVTNIKN"
FT   CDS             complement(202866..203846)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0156"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01733"
FT                   /db_xref="GOA:C9YHW5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW5"
FT                   /protein_id="CBE01733.1"
FT                   /translation="MNLKLIWINILNPVFIKNEIKRKKIQIIIFFFINFGLTYSLGLLL
FT                   YYNKFIDPENFASFMMILPLSSVAIAKFYTEGLNNDMYEFYSLIILFFLIYSLLIVLKL
FT                   LNLINNNEFIIINLILTFISSLSIIIYSSNKKNLYPVKNIKLGSLLIIYFMISVIVPTS
FT                   FILILQGAQPNYSGIIKFIFTPITSLTTIYIFFSEEYAWRGFLQNIFFDKFGKKLGVII
FT                   LGMCWSLWHLPLIFTLYTPEAPILGVILRSIHIVGISIFLGYLYIKTKNIWFCAIIHVL
FT                   NNSAFLITNSKESTITYHDILIVSMVVLIFYVPFLFTKEYKNNLE"
FT   CDS             204974..205441
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0157"
FT                   /product="putative glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01735"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW6"
FT                   /protein_id="CBE01735.1"
FT                   /translation="MKFLNVLIVVEDIEKSKKFYYDILGLKVICDFGENVVLEGNISLQ
FT                   EKKLWLEFINKSDSEVKFNGNDAELYFEEDNFDTFVERLSTMKGIDYVHLAIEHRWGQR
FT                   AIRFYDLDGHIIEIGETMSSVCRRFLDSGLSIDEVAKRMDVTVEYIESVLE"
FT   CDS             206612..207325
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0158"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01736"
FT                   /db_xref="GOA:C9YHW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW7"
FT                   /protein_id="CBE01736.1"
FT                   /translation="MINIIICEGKKSERVILNDYINTFFYNYNFEYNIKEFENGGDLLK
FT                   KYPNNVDIIFMDIDLNDENGFNVSKEIKKFDESVRIIFVSSSNKYIKKGYEIGVYRYLE
FT                   KPLKYSLFKEAISSYLKECYKNEAILSIKCKCKIYFIKVDDILYLEVLKNDLTIHTEKG
FT                   IYTFKNSMKEIESNLEEHNFFRCHKSYLINLMKVNMLDIENNIVFINQNSIIVSRYKIK
FT                   LLREKLNSCLVDVII"
FT   CDS             207598..209370
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0159"
FT                   /product="putative lantibiotic ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01738"
FT                   /db_xref="GOA:C9YHW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW8"
FT                   /protein_id="CBE01738.1"
FT                   /translation="MENGKFQFFKGVRNCFNMIYLHDKRYLFISMFMAIFQGIVPSISL
FT                   LVSQNIINNMQTFSKSVKEILVLLIMYLIINIIPSIFQSFYGYYRIKFNKNFEKHIETM
FT                   MLEKSLTLSLKDFEDDNTYDMINRAQSQKGFNITILSENLISIIRESVSTLSLIVVLSQ
FT                   FQLWLIIVVIVIPVLKSLYSIKLGKEQYDVSVNRTWKERKAWYIDYLLSKGYAYKEIMV
FT                   FRIGSKLINHYKKLKEDIISQDMNIAKKNFIATLLCTVLDSIVSAGIIGFIIIQGILKK
FT                   ILIGDATTYIQAVQSIKDNVESIFSLFSSVIQDLFYTDLLFKFLDYNCKEDSIEHIKIF
FT                   EKIGDINKIELINISYKYNHSSEYSLKNINLTLNKNDPIAILGKNGSGKTTLLKILLGF
FT                   YDDYEGDILINGKNLKDIEKDEYIRKVSCMFQDYIKYEATLKENVAMGDVYKSNLEEKV
FT                   KSKLKETKLKPSIYEEDGLETILGTWFGKKQLSMGEWQKVAISRTLMKDADMYIFDEPD
FT                   SSLDSEAGNELLSLYKKTFENKIGIFITHHIQHAKKITNNIVVLENGKLLESGRHDELM
FT                   DKKGVYFNLFCNCK"
FT   CDS             209392..210813
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0160"
FT                   /product="Radical SAM-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01740"
FT                   /db_xref="GOA:C9YHW9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024001"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHW9"
FT                   /protein_id="CBE01740.1"
FT                   /translation="MNQKPFIHTFKAGKSYFIYDVNTDKILKVNAAVYNYLNKIEHNLE
FT                   KESDWNIEIEDEINTLINYGFLKNKRVNKTMHPETKYIKYHIENNLSSIILQVTQNCNL
FT                   RCDYCIYSGSYSNRVHTNKRMNIDVAKRSIDYLIKNSSQLNEVSVGFYGGEPLLEFDLI
FT                   KQIVEYVKVVGEGKEIYFNLTTNATLFNEEIIEFFVKNNITTMISLDGGKEIHDKSRKF
FT                   ANTGEGSHDVVLKNVRYIKNKYPEYYKKNITFNTVINSENDYISIDDFISKNETLKDSN
FT                   FLASTLNNNYSDKEIVSSDEYILGKSYDRFLTLLNKLKFIKDESMSPLSRIERALLDDF
FT                   RYEKNIEGRLELPDVWHHGGPCIPGAFRIFVTTDGEFFPCERVSESSKMGMIGNLDSGV
FT                   DIEKAEKLLNIGKLYEEQCSDCWAYSYCDICIAKIDDTKCNENEIKPHDCDRIRHSTEN
FT                   NMKDYCVLKSLGYQY"
FT   CDS             210842..211912
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01741"
FT                   /db_xref="InterPro:IPR023823"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX0"
FT                   /protein_id="CBE01741.1"
FT                   /translation="MEKVLIYPFNYNFFTILNHCNKISDIEINSLVSPSGWGLCNKEYN
FT                   VNNIITKVTNDFQSELKKNSLVWFVDSKENLDLEKFIIPKLKVALKEGKKILYTRDDLN
FT                   KISRYISHYEFKKINEWNLEKYEIRDIEGISQINTPIIFICGLYGGLDTFDVNIRIGEE
FT                   LRKRGFSILQFGPKKESYLFKMIPIPEFMFDDSISSKTKIINFNHFIKDKEVEAKPDLI
FT                   IIEVPGELFPFSRKMVGNFGIRAFEISNAVINDCGILCIPSSIYDREYCEELKYFIKGR
FT                   HGINIDYFSIEKKVIDTYETEVKQKFSYMSLDENFFVEDIEDYEKTFFIHDNKQLLELV
FT                   DNIVNQLKEYAKVISI"
FT   CDS             211928..212179
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01743"
FT                   /db_xref="InterPro:IPR023972"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX1"
FT                   /protein_id="CBE01743.1"
FT                   /translation="MNYTEKELLLENIFFDVTGINFNKNNNLKKELFFSPSLHIQPREL
FT                   LLVFCEVIENFNIKIPEEKLLNRQFTSFDNVLKIINMV"
FT   CDS             212230..212433
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01745"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX2"
FT                   /protein_id="CBE01745.1"
FT                   /translation="MSFGKRIEMNNIGVETRGVCTIMCPYTCKMMASSSCNCKNNDYNA
FT                   RGGSYNTYYNKLIHGQRTPDGM"
FT   CDS             212917..213210
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0164"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01747"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX3"
FT                   /protein_id="CBE01747.1"
FT                   /translation="MISMIMMLIGVLFIVFGIILTAVEIKGKMPGFYGVGQNAVRKNAI
FT                   GIIAAGIALIFFRNGLDSIDSILTYGVFLVIELVVIGLYFLIRIKYDKDGNL"
FT   CDS             complement(213342..214691)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0165"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01748"
FT                   /db_xref="GOA:C9YHX4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX4"
FT                   /protein_id="CBE01748.1"
FT                   /translation="MEKAKKLGLFSMILLGINSIIGSGIFLLPGKVYSLAGQNSMFIYI
FT                   FATLLVLSILLCFAEVGSMFDKNGGAYLYSKKAFGDFIGFEVGTMSWFIRIISWSTLAV
FT                   GFATALGSFWPESATEYKGCIAAILVTLLSINSLFGIKSTKIMNNVITIAKLVPLIVFV
FT                   IVGIFFIKFVNIVPSGNVVNSSMGPAIILVFYAFTGFESFIVASGEMENPKKNLPIALI
FT                   TTIFICAIIYILIQIVCMGILGDRLFENSIPIADASSVFLGNYGKVFISVATLISIFGI
FT                   NIGSSIVTPKCGSSLAEEGSLPAFIGKTNKYGAPYVAIIISLICCIPLVLTGSFEQLAV
FT                   MSVIARFAQYIPTCLSVIVLRKRTDVKASFKIPFGPVIPMVAILGSLWLLQQAWAEDIS
FT                   KPITQNRVLIGLGAMLLIAPLYIFMKKNKEIEHKNKSEDSKLYISREKIQ"
FT   CDS             complement(214728..215948)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0166"
FT                   /product="putative amidohydrolase/peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01750"
FT                   /db_xref="GOA:C9YHX5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX5"
FT                   /protein_id="CBE01750.1"
FT                   /translation="MQQALKLKYQTKELGKDFVIESCNSIKPWLINIRRELHKIPELAL
FT                   EENLTKQKVISYLKEIGIDYMEFTKHNGIMAYILKESADKTICIRADMDALPIEEENNI
FT                   PYKSIHSGKMHACGHDAHTTMLLGACKVLHSIKDKLNVNVKFLFQPAEEGFGGAKFLVE
FT                   DGCLENPKADYIFGLHVMPHIETGLIETKYDTLNASVDTIKISIKGKRAHGAYPENGID
FT                   AIVTASQIVTSLQTIISRNLEPNNAAVLTIGKIYGGDAHNVICEDVKLEGTLRTLNSKT
FT                   RNFMIDKIAKIVGDTASAFGCVGTLHVSDENYPAVINEKELVDTVISSTKELLGEEKFI
FT                   LRPNPSLGGEDFSFYTEHCKGAFFHLGCKNEEKGLISPLHTSSFNIDEDCLPIGVMMHV
FT                   MNTLYFN"
FT   CDS             complement(216317..218329)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0167"
FT                   /product="putative sigma-54-dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01751"
FT                   /db_xref="GOA:C9YHX6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX6"
FT                   /protein_id="CBE01751.1"
FT                   /translation="MKKSVALVNDSRKDLIDFLENNLKLVFGDSININRYFINEINDND
FT                   IINDDVILVMSVERLDKIINNILDKKKVIVVRRTFREDKIYNLLSLPQGTNALIVNDSD
FT                   ETTLETISLFYKIGVTNIRPIPYMNDNNYKNIKIAITPGVPEKVPSFISDIFDLGHRYI
FT                   DISTFIEIINLLQIDSKEIQSNLVKYSEEIISLDTGIKDKYKELFLKIEELDTILNLSK
FT                   DGILFTSKDGEINTYNSKVKDILDINEDIYGKYIDDIFVDSLKVLLSEKEILDKVVVFN
FT                   KKYINVNKKNIYNRDEKMGTYYSLQEITYIKKLEQNLTKKLREKGQIAKYTFKDIKTNS
FT                   PKMFECIDLAKKVSKSDLSILIRGESGTGKELIAQSIHNNSNRKNQPFIAVNCAAVPEN
FT                   LLESQLFGYDKGTFTGGLKDGKQGLFELANNGTIFLDEIGDMPLELQTKLLRVLQEKQI
FT                   MPVGSHNVINIDVRIISATNKNLEQMIDNSQFREDLYYRLNTIPINIPPLRERKEDILI
FT                   IMEDLINKKLVITPEAKKLIQNYMWKGNIRELQNVTSYLNIMCEDIVLEKDLPPNLRSS
FT                   DNKNTSLKLKYSKNDILNILEILILNKESDVGIGRGLILKALLDKNLQITEGKIKKIFE
FT                   YLKKEELIICSSGRYGSKITQKGEDFYNKLKYKGL"
FT   CDS             218800..219450
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0168"
FT                   /product="putative cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01753"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX7"
FT                   /protein_id="CBE01753.1"
FT                   /translation="MKAEKTSIYPIIKNNLNKISIVEYKKGQRFVASDKDLQEVFFIIE
FT                   GVALVECTTRGGNKFLVDIVPENEFIGKISYIYEHNLKCDIFAKTNIKLFRFEKNVFEE
FT                   FYLKPDFIALFHRKCTRRIYELYKTRMVRELFSCTEVIAYCISNKQENNVCNIKAIRNF
FT                   SEIYSISRKSRYHSLLKLTEKEIVKKMGNTYEILNYDELHKLAFEVKEFLEDE"
FT   CDS             complement(219590..220966)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0169"
FT                   /product="putative drug/sodium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01755"
FT                   /db_xref="GOA:C9YHX8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX8"
FT                   /protein_id="CBE01755.1"
FT                   /translation="MQELFSLKDENKRFYKILLSLCIPIIIQNLISTSVNVIDTIMISS
FT                   LGETSVASVGVANQFFFLFNMSLSGITGGAGVFISQFYGKKDVSNIRKVTGLTCVLAIV
FT                   LSFVFVIPALLTPKPIIHIFSYDSEVVKLCIDYFSIAVFSYPLIAVSTVFSTGSRGVRN
FT                   PKLGMICSAFALVTNVILNYGFIFGNFGLPALGVKGAALATVIARICELILMITYVYLY
FT                   KKDYILKFGLKNLKAIDKIFIKSFSSKSFPIFVNDSVWAIGTVLYSVAYARAGTSAIAA
FT                   SQIATSTGNFFIMTAVCIASGASIMLGNELGADHIKRAIEYAKKFSILVFSAGLILGII
FT                   LILNIPLLLKMFSVSDSLASDITKIFFIMGILMALKSFNTLVIIGILRSGGDTKYALFL
FT                   ELGCMWLASIPLTFIAAFKGAPIFVLVLLTYSEEVVKFIFGVPRALSKKWAINIVKEID
FT                   "
FT   CDS             complement(220982..222895)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0170"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01756"
FT                   /db_xref="GOA:C9YHX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHX9"
FT                   /protein_id="CBE01756.1"
FT                   /translation="MIVLSCNNLNKSFGIDSILENISFTVNEGDKIGIIGVNGTGKTTL
FT                   FKIISGIYGYDSGDIYTSKDCEIGYLEQNTNFYSDNTILEEVLEVFKNLIEMESYLREL
FT                   EVKISEESTKTNSPIIEKIMDEYSHKLELFSDLNGYGYKSEAKGVLKGLGFSDNDMDKP
FT                   ISILSGGEKTRVLLGKLLLKKPTLLLLDEPTNHLDSEAIEWLEVFLKQYKGTVMLISHD
FT                   RYFLDQSVNRIFEVHNKKLKVYNGNYSKFVELSKIEKELELKKFEDQQKEIKKQEESIE
FT                   RLKAYGREKHLKRARSKEKALDKVDVLDKPEAYRKKARIQFTPSVQSGNDVLQIRDVSM
FT                   GYGERILFKDLDLDIYRGEKVALIGANGVGKSTLFKIITNELQPLSGNIKFGTNVHVSY
FT                   FHQEQKTLNLDNTIIDEIWENNTHLTQTTLRNMLGAFLFVDEEVFKKISTLSGGERARV
FT                   AILKLILSNANLLLLDEPTNHLDIDSKEVLEEALTNYDGTIFTISHDRYFLNTVVDKIL
FT                   VLDENGITEYLGNYDYYIDKKRQIQEMSIIEEKEEKTRTQIKDEKRKEREQREIEKKNR
FT                   IKRQNIEKEIEKLEIEIEKLDILLCQEEVYSNPDKAKEVSQEKINLENNLASLYDEWEE
FT                   FM"
FT   CDS             223031..223663
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0171"
FT                   /product="putative redox-sensing transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01758"
FT                   /db_xref="GOA:C9YHY0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY0"
FT                   /protein_id="CBE01758.1"
FT                   /translation="MLGNKNISMAVIRRLPKYHRYLGDLLDRDIQRISSKELSDIIGFT
FT                   ASQIRQDLNNFGGFGQQGYGYNVEALHTEIGKILGLDRPYNAVLVGAGNLGQAIANYAG
FT                   FRKAGFEIKALFDANPRMIGLKIREFEVLDSDTLEDFIKNNNIDIAVLCIPKNGAQEVI
FT                   NRVVKAGIKGVWNFAPLDLEVPKGVIVENVNLTESLFTLSYLMKEGK"
FT   CDS             223802..224341
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01759"
FT                   /db_xref="GOA:C9YHY1"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY1"
FT                   /protein_id="CBE01759.1"
FT                   /translation="MVFVEELWKKAIEFHGHECPGLAIGFKAALAARKYLGCKQSGDEE
FT                   IVCISENDACGIDGIQVVLSCTMGKGNLLLRMTGKSVYHFFNRENGKSIRIYVKSKPFQ
FT                   MDREGYKKYLLESDFEEIFEITDTKLRLPEKARIFKSLKCEVCGEFASEQYIRIEEGKK
FT                   VCLDCFNKYERFYEEY"
FT   CDS             complement(224517..224687)
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="CDR20291_0173"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01761"
FT                   /db_xref="GOA:C9YHY2"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY2"
FT                   /protein_id="CBE01761.1"
FT                   /translation="MAYKITDACISCGACEAECPVSCISAGDDAYVIDAGSCIDCGSCA
FT                   GACPVDAPQPE"
FT   CDS             224972..226039
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0174"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01762"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY3"
FT                   /protein_id="CBE01762.1"
FT                   /translation="MKNKLVYICIMSLLLFVVGCSNNPNKESTIKKDSKNNQSQVKEEK
FT                   REPVKKDITISFAGDVTMGNYKGSSYYGSFDHEFKRQGEDYNYFLKNVKPVFEKDDLTV
FT                   VNLEGPLTTASNAKEKKFAFKGKPGYVNILKSGSIEAVSIANNHSEDYFEEGMKDTQFI
FT                   LDENKINYFGLGKDAVVDVKGIKVGLLGYNGLSTEYNEKNLKQMEDDIKSLKKKSDVVV
FT                   VYFHWGIELDYYPDKKQKDFAHYAIDKGADLVMGSHPHVIQGIEKYKNKYIAYSLGNFC
FT                   FGGNKNPSDTDSYIYQQTFTFSDNKLTSIKEPNIIPTSITSSSSRNNYQPKVLDGSEKD
FT                   RVLNKLEKISKDLNK"
FT   CDS             226209..228110
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0175"
FT                   /product="putative oxidoreductase, acetyl-CoA synthase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01764"
FT                   /db_xref="GOA:C9YHY4"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY4"
FT                   /protein_id="CBE01764.1"
FT                   /translation="MACNTCKMCESADKKLESFVASKDVETAFHRTEDQKVKCGFGLQG
FT                   VCCRLCSNGPCRVTPKSPRGICGADADTIVARNFLRAVASGAACYLHVVENTAKNLKNV
FT                   GITKGVVKGEKTLNQLAEMFGIESDEKYDKCIKVADKVINDLYKSRDDKMELVEKIAYA
FT                   PRVKKWKELGIMPGGAKSEVFDAIVKSSTNLNSDPVDMLVNCLNLGISTGLYGLTLTNL
FT                   LNDVMLGEPVIRMAPVGFNVIDPDYINIMITGHQHSTFANFQDRLKDEDVIKLAQSVGA
FT                   KGFKLVGCTCVGQDLQLRGEHYQEVFAGHAGNNFTSEAVLSTGAIDIVLSEFNCTIPGL
FT                   EPIADKYKVKMVCLDDVAKKANAEYIGLDRSKLDELSNTLIEKALESYKERRGSIEIDI
FT                   PKDHGFEQSLTGVSEKNLKAFLGDSWKPLINLIAEGKIKGVAAVVGCSNMTAGGHDVNT
FT                   VELTKELIKKDIIVLSAGCSTGGLENVGLMSPGAEELAGENLKEVCKTLGIPPVLNFGP
FT                   CLAIGRLEIVATELAAELGIDLPQLPLVLSAPQWLEEQALADGAFGLALGLPLHLALPP
FT                   FITGGKLVTEVLTEKLKDLTGGHVIVNPDPKSSANQLEEIIIDRRKNLGLKDVECNA"
FT   CDS             228166..228576
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0176"
FT                   /product="putative oxidoreductase, electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01766"
FT                   /db_xref="GOA:C9YHY5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY5"
FT                   /protein_id="CBE01766.1"
FT                   /translation="MLKHNKDYDMYTLDLENIDNDSRGHIELDSKHNNPVPILCRHCDE
FT                   PECVLACMSGAMHKDSESGIVSYDEEKCGSCYMCVMSCPYGLLKPDDRSKQNILKCDLC
FT                   KDEEYPRCVANCPSGAIELQKEENDELCSVRG"
FT   CDS             228674..229777
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0177"
FT                   /product="putative oxidoreductase, NAD/FAD binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01767"
FT                   /db_xref="GOA:C9YHY6"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY6"
FT                   /protein_id="CBE01767.1"
FT                   /translation="MLHHVISEHRTLKQINFVDEDFMEQNNVKWIAGKTVKGIDINKKV
FT                   VQTEDITVNYDKLLIATGASSAIPPIKNLRDGNFVYSVRNIDDIYKIKEKAQNSKNVVI
FT                   IGAGLVGIDALVGLFKYEQLNISVAFMEKYILDRQLDEYTASVYENKFKEKGVKFYPSA
FT                   SIQEIVLDNSKNVTGVAFSNGEVLDADMVIVATGVKPNADFLDGTGIEYDRGIIIDDMC
FT                   QTTQKDIYAAGDVVGKNAIWPLAVKQGIVAAYNMVGKDKKIEDEFAFKNSMNFMDIPTI
FT                   SIGMNTPVDDSYKVLTRHGINDYKKFVFKDNVIYGAVIQGDISYVGVLTYLIKNKVEIY
FT                   DLENRIFDVCYADFFNIKENGEFCYSV"
FT   CDS             complement(229916..231103)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0178"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01769"
FT                   /db_xref="GOA:C9YHY7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY7"
FT                   /protein_id="CBE01769.1"
FT                   /translation="MNITKNFLKDYLEKFGETPFLVRLKDEEEFLIGEGSPQFKVIVNN
FT                   DISKSELLKSTSLALGEAYINRDIEVEGDLFLTLNLLLKQIDKFNIDNSAVKHLLHSSN
FT                   SMRHQKKEIHAHYDIGNDFYSLWLDKTLSYSCAYFRNDNDTLYDAQVNKVHHILTKLNL
FT                   EEGMSLLDIGCGWGFLLIEAAKKYKIHGVGITLSEEQFKEFNARIKEENLQDYLEVRLM
FT                   DYRELKKSDLMFDRVVSVGMLEHVGRENYELFIKNVNAVLKDGGLFLLHYISGLQESYG
FT                   DPWIKKYIFPGGVIPSLREMIHICSDYKYHTIDVESLRLHYVKTLLYWQKSFSENLPKI
FT                   KEMFDDKFIRMWDLYLCSCAAAFNTGIIDIHQILFTKGIKNDLPLTREYMYNCSK"
FT   CDS             231373..232200
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0179"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01771"
FT                   /db_xref="GOA:C9YHY8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY8"
FT                   /protein_id="CBE01771.1"
FT                   /translation="MMEVYALVGSSGTGKSFKALEFAYENDIEYIIDDGILIYKNKVLA
FT                   GISAKQANTTIEAVKRAIFYNLEHRQEVREAIKKENIRKILIIGTSKKMVNQIVERLSI
FT                   GRVCKFINIQDISTKYEIEIAKQARKEGNHVIPVPAVEIKSMASGLSINSLKRLFRKGN
FT                   NRNMVVLEKTIIRPTFSYIGKFYISADVIKQIIEYEVYNFGSIDRINKINIENCNNFMN
FT                   IFVSININDLETIKKIEDIQQTIKKSIEKMTLVNVQKIDINIHKIKKINFLQC"
FT   CDS             232329..233594
FT                   /transl_table=11
FT                   /gene="gluD"
FT                   /locus_tag="CDR20291_0180"
FT                   /product="NAD-specific glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01772"
FT                   /db_xref="GOA:C9YHY9"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHY9"
FT                   /protein_id="CBE01772.1"
FT                   /translation="MSGKDVNVFEMAQSQVKNACDKLGMEPAVYELLKEPMRVIEVSIP
FT                   VKMDDGSIKTFKGFRSQHNDAVGPTKGGIRFHQNVSRDEVKALSIWMTFKCSVTGIPYG
FT                   GGKGGIIVDPSTLSQGELERLSRGYIDGIYKLIGEKVDVPAPDVNTNGQIMSWMVDEYN
FT                   KLTGQSSIGVITGKPVEFGGSLGRTAATGFGVAVTAREAAAKLGIDMKKAKIAVQGIGN
FT                   VGSYTVLNCEKLGGTVVAMAEWCKSEGSYAIYNENGLDGQAMLDYMKEHGNLLNFPGAK
FT                   RISLEEFWASDVDIVIPAALENSITKEVAESIKAKLVCEAANGPTTPEADEVFAERGIV
FT                   LTPDILTNAGGVTVSYFEWVQNLYGYYWSEEEVEQKEEIAMVKAFESIWKIKEEYNVTM
FT                   REAAYMHSIKKVAEAMKLRGWY"
FT   CDS             233787..234443
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0181"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01774"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ0"
FT                   /protein_id="CBE01774.1"
FT                   /translation="MYFLPPHDYKLEELDWIFGHELMYFKSKDLHLKYLVLFLKIVYWF
FT                   NPFIYIMEKYMDLDCELYCDERVLKNCTVQQKQEYALTIVNSMKRGINFSNKFVTGLNK
FT                   QSDIRKRVMNMFSEKHKNGILMALIISLFSSITFFKFDSTSLIEENDFLERSRYAFEGR
FT                   QEDMFVTIDSTYADAPIKLRKEHEENCRVNGIVPKDSDSIEIIPRFYKDCMDLKK"
FT   CDS             234774..235907
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0182"
FT                   /product="putative membrane-associated metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01776"
FT                   /db_xref="GOA:C9YHZ1"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ1"
FT                   /protein_id="CBE01776.1"
FT                   /translation="MSNFILNGIFRTVIVSSLSILLILIFKKNVFKRFSKKFNYYIWMI
FT                   VVIKLFLPFTYYTFTINILRSKKHININNINLEGFNNVSTISNNIILYTWIITVVVYLI
FT                   YTIFKYIKLKNLINDLSYDVDDREIVNLYKNILEEFNITKDIKLKYSYEVETPAFFNSC
FT                   VLLPPHEYKLKELDWIFRHELMHFKSRDLYLKYVILFLKTVYWFNPFIYIMDKHIDLDC
FT                   ELYCDERVLKNRNSEEKKDYALTILNAMRKGSNTSNKFIAGLHKQSDIKKRVMNMFNEK
FT                   YKNGILMALTLCLLSSITFLKVNSTSIVNLNVLPKGFEDLRTVSSIRFSVIGFTYADAP
FT                   KNMREEYKINCESLGLIPKDSDKIEVGVEYYDSLLND"
FT   CDS             join(236171..236365,236367..236435)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0183"
FT                   /product="putative membrane protein precursor (pseudogene)"
FT   CDS             236834..237856
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0184"
FT                   /product="putative cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01779"
FT                   /db_xref="GOA:C9YHZ2"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ2"
FT                   /protein_id="CBE01779.1"
FT                   /translation="MKKKILIPVFASVMALSVSSIVNADEVNDSSQNKDDKTNTELNLG
FT                   EYKEVKYKVAKIKDGVAIKIREEGQVQNIAYSGDEFTVLGTQGEWVKVKVEDGEGWLAT
FT                   RYVDISEGVGYTNADKVNLRKDKSESSEVIEELEKGSSLLVLEDNGDWLKVKDGETEGY
FT                   VKSSYISDKAPVIEEPQVNPSIDQNVDSTNNNQQNNANTNQQNNNSNVPTANSNAVQAV
FT                   LNLAYSKQGCPYVWGAEGPNTFDCSGFTQYVYRNAVGKNIPRTSKAQSKYGQTVSKANL
FT                   QPGDLVFFTTNGSGSVSHVGIYVGGGNMIHSPSTGKTVSVTSINSSYYTARFVTAKRIL
FT                   "
FT   CDS             238152..239072
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="CDR20291_0185"
FT                   /product="aspartate carbamoyltransferase catalytic chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01780"
FT                   /db_xref="GOA:C9YHZ3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ3"
FT                   /protein_id="CBE01780.1"
FT                   /translation="MLKSRNLIQPEDFSIEEIDEILELAQKIIDNPSKYSRICEGKLLA
FT                   TLFYEPSTRTRLSFESAMNRLGGRVVGFSEPNSSSASKGETLGDTMRIVSGYVDIIAMR
FT                   HPQSGAASEAARYTEVPFINAGDGKNQHPTQTLTDLLTIKSLKGTLESHTIGLCGDLKY
FT                   GRTVHSLVKAMARYKNTKFVFIAPEELKMPDYIKEAIKGHAYYETNNLDDVIGSLDVLY
FT                   MTRVQQERFEDKSEYERLKNYYILNKAKLEKASKDMLVMHPLPRVNEIDIDVDSDDRAV
FT                   YFKQAKYGMYVRMALIIKLLGINED"
FT   CDS             239111..239803
FT                   /transl_table=11
FT                   /gene="pyrK"
FT                   /locus_tag="CDR20291_0186"
FT                   /product="dihydroorotate dehydrogenase electron transfer
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01782"
FT                   /db_xref="GOA:C9YHZ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ4"
FT                   /protein_id="CBE01782.1"
FT                   /translation="MYKILENIYIGEDMYRMKVKGNFEGKMGQFYMLRAWDTYPVLSRP
FT                   ISIHDIDEEGITFLYKVVGEGTQILSNLKVNDNIKLEGPYGNGYAKVDGKVALVGGGIG
FT                   VAPLYLVAKNIKNCDAYLGFREDVILEDEYKQVCNKVYTTVGNTFVTDIIDVEKYDYIL
FT                   TCGPTPMMEKLVKMVEGTKTRIMVSLENHMACGVGACLVCTCKTNGGNKKTCKDGPVFW
FT                   GEDVIFNG"
FT   CDS             239850..240698
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="CDR20291_0187"
FT                   /product="dihydroorotate dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01784"
FT                   /db_xref="GOA:C9YHZ5"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ5"
FT                   /protein_id="CBE01784.1"
FT                   /translation="MASGTFGFGKEYNEIYDIQKLGGISSKGLTLNKKPGNNGMRVHET
FT                   PSGMMNSVGLENPGVQGFIDYELPFFSKLDLVRIANVGGGTLEDYLLGVQMLNDKPIDI
FT                   IELNISCPNVKAGGMAFGIKNEVAREVVREVRNITKLPLVIKLSPNAEDIVGMAKVCEE
FT                   EGADGVSLVNTFKAMAIDIKNRRPVFENVYAGLSGPAIKPIALRMVHEVCKNVNIPVMG
FT                   MGGITKATDAIEFIMAGATCIQVGTANFMNPRIGIEIIDGINEFMDREGIKSLDEIRGI
FT                   I"
FT   CDS             240783..241367
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CDR20291_0188"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01785"
FT                   /db_xref="GOA:C9YHZ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ6"
FT                   /protein_id="CBE01785.1"
FT                   /translation="MSKVDVVDILKKSDALLEGHFLLSSGKHSNRYVQCAKVLRFPEYA
FT                   AEVLSTVVEQIKDLDIDLVVGPAMGGVIVSYELGRQLGKEAVFTERKDNTMELRRGFEV
FT                   KKGAKIIIAEDVVTTGKSTMETKRVLEALGGEVVGVACIADRTNHDIGMPIYSAIKLDI
FT                   QVYESDECPLCKEGKLPVVKPGSREFKELGM"
FT   CDS             241582..242508
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0189"
FT                   /product="putative ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01787"
FT                   /db_xref="GOA:C9YHZ7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ7"
FT                   /protein_id="CBE01787.1"
FT                   /translation="MKNQLNENHKKVVFFGVGAVGATFAEQFFNSKYDFKILCDNERKK
FT                   RYLEEGFIINGKRYDFNYVTKDEYKQEADFIIIGLKYNNLKENIKELDGLVGKNTVIMS
FT                   LLNGVDSEEIIGERFGIGKMVYSYVTNIDAKKINNNIIHTTNGIIVFGNKDNSEDRKTN
FT                   IITEVFDDVNIEYILSKDIQRDMWWKYMVNIGVNQTSAILGAPYGVFQSSEHLRELAKS
FT                   AMREVVAIAQAKDISLTEDDVENSLHRILEHSKEGRTSMLQDVEAHRPTEVDMFSKNIC
FT                   KLGKKYSIPTPINQTLFYMIKVIESRF"
FT   CDS             complement(242560..243450)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0190"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01789"
FT                   /db_xref="GOA:C9YHZ8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ8"
FT                   /protein_id="CBE01789.1"
FT                   /translation="MFEELKTFVAVVEYKNFTKAGEYLNLSQPSVSKHIKNLENYFKVV
FT                   LINRSIKQKTIFITESGQILYKRAKEILNLLNITYHDVSQVSDAITGHLKIGASLTIGE
FT                   YILPNFLALFSQKYPDIYVEVFIKNTSIVSSHVKDYILDIGLIEGTCSSPSFIQEYFFE
FT                   DKMVLALPYNSHLLKDFSFDKLQDQKWIVREDGSGTRDYLDMFLSVKEIIPKSMMVFGS
FT                   NYAVKESVRNNLGITIVSNLVTSLPVLNNELSVIELGSSYNRHFSYIFPKDITLSKAAT
FT                   IFIEELKIFSNLNSI"
FT   CDS             243638..244669
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0191"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01790"
FT                   /db_xref="GOA:C9YHZ9"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:C9YHZ9"
FT                   /protein_id="CBE01790.1"
FT                   /translation="MLKKKSSLTLKTIREILPGLFISVLVGYISIFISILIPKVGAASI
FT                   SIFLGMFVGNLFLNQKVFQKGYKFSETDLLSYSIVLLGATLSVSTLIDLKVSGILFIIL
FT                   QMTITIIAALYIGKKLGFEENFRFLMASGNAVCGSSAIGAIVPVVNATDKEKGIAVTIV
FT                   NVTGIFLMFLLPIISQFLYSHELVKTSAMIGGTLQSIGQVVASGAIVGENVKDLATIFK
FT                   IVRVIFLVVVVLVFGHMKNQSNREILEEEKDEIKKKKVTIPWYVIGFFITCALFSMNII
FT                   PKEVSVLCKEISNKLEIIALAAIGLKVNVKDLVKQGKEVSLYGLFVGTVQVVSAVVLIK
FT                   IFI"
FT   CDS             244963..245838
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0192"
FT                   /product="putative DNA glycosylase (DNA repair protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01792"
FT                   /db_xref="GOA:C9YI00"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI00"
FT                   /protein_id="CBE01792.1"
FT                   /translation="MNVYEKGNGVILEGVTDFDPVHIFECGQCFRWHKQEDGSYTGVAR
FT                   GRILNVKKENDKIYLNNTNLKEFNSIWYNYFDLGTDYTEIKNKLKNMDEYLNKATEFGW
FT                   GIRILRQDGWEMLISFIISSNNRIPMIQRAIENLSRKFGKYIGEYEGNEYYAFPTPEEL
FT                   NKASQEEIRACQTGFRDKYIKSTTQAVIENNDEVSEYTNLSTEDCRKELLKFNGVGPKV
FT                   CDCIALFGMQKYDSFPVDVWVKRVMQEFYIDEDMSLPKMRTYGIDKFKEMSGFAQQYLF
FT                   YYARELGIGK"
FT   CDS             245856..247346
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="CDR20291_0193"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01793"
FT                   /db_xref="GOA:C9YI01"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI01"
FT                   /protein_id="CBE01793.1"
FT                   /translation="MGVIGTIFLFYLIISYLAGAIISVIILLENRDPAKTMSWLLMFII
FT                   FPGVGLMIYAISGRNIRKRKLFKTQKLANNIKEKKLFDTLEKITEIVELEKESIKQNKL
FT                   LRDEEDGSYRKRVINMLLKTGMFPFTKNNKVDVFVDGNEKFKRLIEDIREAKDHIHLEY
FT                   FIIKDSEIGRVLKEELIKKAKEGIKIRILYDDVGCWRFWFNRKFFREMREVGIEIAAFL
FT                   PTKFPIIGGKLNYRNHRKIVVIDGIIGYTGGINIGDEYLGKNDKFGYWRDTHIRIKGIS
FT                   VYMLQMTFLIDWYYTTKEVLVTKNYFPSVGNVGESMIQVVASGPDSDWEDIHYAYFSAI
FT                   CQARKNVYIETPYFIPDESLLKAIKSAALSGVDVRIIFPKIADHKIVNIASYSYFEEIL
FT                   RAGGKVYLYNKGFIHSKVVIIDDKIASAGTANMDLRSFMLNFEVNAFIYDEEVIRVMTD
FT                   DFFEDLSHCEELNLEVFKNRNIIQKIKESVARLFSPIL"
FT   CDS             247539..247823
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="CDR20291_0194"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01795"
FT                   /db_xref="GOA:C9YI02"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI02"
FT                   /protein_id="CBE01795.1"
FT                   /translation="MKIRPLADRVVIKKVEAEEKTASGIVLPGAAKEQPQIAEVVEVGP
FT                   GGIVEGKEIKMELTVGDKVIFQKYSGTEVKIEGQEYTILRQSDVLAVIE"
FT   CDS             247856..249484
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="CDR20291_0195"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01797"
FT                   /db_xref="GOA:C9YI03"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI03"
FT                   /protein_id="CBE01797.1"
FT                   /translation="MAKEIKFSEETRRALEAGVNKLADTVKVTLGPKGRNVILDKKFGS
FT                   PLITNDGVTIAKEIELEDRFENMGAQLVKEVATKTNDVAGDGTTTATVLAQAIIREGLK
FT                   NVTAGANPILLRKGIQKAVIVAVEELKNQSRIVETQEAISQVASISAGDEEVGKLIAEA
FT                   MEIVGKDGVITVEESQTMNTELDAVEGMQFDRGFVSAYMVTDVDKMEAVLNDPYILITD
FT                   KKISNIQELLPVLEQIVQQGKKLLIIAEDVEGEALSTLVVNKLRGTFDVVAVKAPGFGD
FT                   RRKEMLQDIAILTGAQVISEELGYDLKEADLSMLGRASSVKVTKESTTIVDGSGDKKAI
FT                   EDRVTQIKHQVEQTTSDFDREKLMERLAKLAGGVAVVKVGAATEVELKERKLRIEDALN
FT                   ATRAAVEEGIVAGGGTAFVSVIPAIGTLIESLEGEVKLGAQIVKKALEEPLRQIAINAG
FT                   LEGAVIVQNVVNSEAETGFDALNEKYVNMIEAGIVDPTKVSRSALQNAASIASTFLTTE
FT                   AAVADLPEKEDAGMPGMGGGMPGMM"
FT   CDS             249746..250486
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0196"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01798"
FT                   /db_xref="GOA:C9YI04"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI04"
FT                   /protein_id="CBE01798.1"
FT                   /translation="MDLRKLLEEVKNENIDIDFALEKLKDLPYEDLGYANIDHHRELRN
FT                   GYPEVIYCEGKSDEHILGIIDKMNQKSSNILGTRCRKETFLKIKEIYNHAEYEEASKIL
FT                   KIQNHDIENIGKGKIVIATGGTSDIPVADEAYHTAKFLGNDVDRIYDVGVAGIHRLLNK
FT                   RHKIDSARVIVAVAGMEGALASVIGGLVDVPVIAVPTSVGYGANFGGLAALLAMLNSCA
FT                   SGISVVNIDNGFGAGYLASMINKL"
FT   CDS             join(250570..251304,251334..251753)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0197"
FT                   /product="putative uncharacterized protein (pseudogene)"
FT   CDS             252135..253670
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CDR20291_0198"
FT                   /product="GMP synthase, glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01801"
FT                   /db_xref="GOA:C9YI05"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI05"
FT                   /protein_id="CBE01801.1"
FT                   /translation="MKHELVLVIDFGGQYNQLIARRVRENNVYCEILPCTASIERIKEK
FT                   NPKGIIFTGGPNSAYLEDSPTISKEIFELGVPILGICYGIQIMSHVLGGVVRKGNKQEK
FT                   EYGKTSITYGKSSLFEGITTNSVWMSHTDLIEKVPEGFTIVANTNDCPVAAMENVERNL
FT                   YGVQFHPEVEHCLEGDKILTNFLYNICKVKGDWTTDSFIEDKIKELKEKIGDKKALCAL
FT                   SGGVDSSVAAVLIHKAIGDNLTCIFVDHGLLRKNEGNDVERIFREKFDINLIRVNAEDR
FT                   FLSKLKGVSEPEAKRKIIGEEFIRVFEEESNKLGKMDFLVQGTIYPDVIESGHGNAATI
FT                   KSHHNVGGIPEDVDFQEIVEPLRELFKDEVRKIGLELGIEEGLIFRHPFPGPGLGIRVI
FT                   GDVTKEKCDILREADAVYMDELRKAGLYREIWQAFATLPDVKTVGVMGDERTYAYLVGL
FT                   RAVTSSDGMTSDWYKMPYDVLERISNRIINEVDGVNRVVYDITSKPPGTIEWE"
FT   CDS             254209..255639
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0199"
FT                   /product="putative membrane-associated nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01803"
FT                   /db_xref="GOA:C9YI06"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI06"
FT                   /protein_id="CBE01803.1"
FT                   /translation="MILNQIFIEDGGIMRNKIIIGITFSLVLLMSGCASKQTAEINVLA
FT                   TTDLHGVIPYELTSYVKEERKKDKNLTLVDAGDFFDSGEVFGSSMDSYFSARYKDGDNN
FT                   TESYIETPISKDMKEVGYDVAVLGNHEFISNNKFYLDNMISDFEKQKINILSANTYKKN
FT                   GDSYTKPYIIKNINTPEGNVKLGILGLTIKEVGERKQWKDGKLVDSKSLELKDQEGYNG
FT                   ELYMNDLVEDAKKWVGIMEKEKPDIIVAVAHTGEKPKKPRNPGNRIQDLAQQVDGIDAI
FT                   VAGHNHVQIEQHDYKNKSGENVIVTEPGKHGEYISKINFKLEKNNDKWNIVDKSSKLIK
FT                   FEKNQESDKFGEFISSINKVSKDKKEIRLSEVKTPEWDKIYVFKSGTSADDIYKTIGYK
FT                   WRNISSPKGDDMVQIVVMNNNKPVSYIYGEAEVMPINIKCDESEYKNNVVTIYPNKNDK
FT                   FKIEKGKQEYSINLKHIQ"
FT   CDS             complement(255787..256662)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0200"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01804"
FT                   /db_xref="GOA:C9YI07"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI07"
FT                   /protein_id="CBE01804.1"
FT                   /translation="MINIRYLEILEAIEQTGTFTGAAKKLHITQSAVSHAIAELEQQAE
FT                   TSLFDRLPRGVCLTRCGISLLDEARSILTACRNLDKKISRLEECTPINIVSSITIASFL
FT                   LPPILSRLKNSFPSLKVNVRVESANSAMDILKSGEADICFWEGIEPQGAFRTILLGSYK
FT                   LCVACAPTFPLSEQTLSLRQLCTFPLLLREQGSAIRDTLDSVLSLSNQKAYPVWESVNS
FT                   FALIKAAEAGLGITILPENLLLDSLLHKKLRLIELDEIDMENKMLAILHKDKNITQPLE
FT                   IILDNISNVL"
FT   CDS             256761..257345
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0201"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01806"
FT                   /db_xref="GOA:C9YI08"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI08"
FT                   /protein_id="CBE01806.1"
FT                   /translation="MKRRRNILNQSRKIYFWLLIINLFISTFTFGGGYVVVPMIRRYFV
FT                   NQKQFFTEDDLMSMAAVAQSTPGAIAINLSALAGYRVAGTLGVVISCTAAIIPPLVILG
FT                   LVSAFYTTFISNAIVTAVLKGMQAGVAALIVDLIIDMCSMILKQRSLFLSTMIPIAFFA
FT                   NFVMSINVIFILSVCCFVCVMQVFYKKRENK"
FT   CDS             257471..257908
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0202"
FT                   /product="putative chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01808"
FT                   /db_xref="GOA:C9YI09"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI09"
FT                   /protein_id="CBE01808.1"
FT                   /translation="MFTDIITISQMTPGPLAVNTSTFVGLQIGGFWGAVAATLGCVLCG
FT                   VVISLFLYNFFQKHQNSTYIFEILNGLKSASLGLIISAAATIIILALFGTNKVYFNSIF
FT                   EMLNWTALIIFFVILLIVRKWKINPIVIIIISGILGIFFYL"
FT   CDS             complement(258037..258273)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01810"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI10"
FT                   /protein_id="CBE01810.1"
FT                   /translation="MLECFIAEDSKIKDGVNIPTLVFKTLHDRYFKTQYFDSYYNSLKC
FT                   KKKLVEINNVHNSYYIDSEKFCQEAYDWFVENQ"
FT   CDS             complement(258583..262011)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0204"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01811"
FT                   /db_xref="GOA:C9YI11"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI11"
FT                   /protein_id="CBE01811.1"
FT                   /translation="MKINNYKNQSIITNPKKFENKYQDLPKTPIELLKVVQSLVIHGDQ
FT                   GKLYGISFNKQQSDEELLRTIPQMLKRIFEINSNPLTIPRNPKQRLVGMCRDYSLLLVS
FT                   LLRYRGFEARMRAGFANYFENELTYEDHWLVEYYDTLTKRWIRIDAQIDDIQKNYFQIN
FT                   FDTHDVGKTDGFLTGSEAWIRCRQGHAHPDDFGYNKNWKGWHSVKGNLLHDFNNMIGLE
FT                   LLPWDLWTELSSKKYNQLTRAEKNLLDEMAEILSSGNIKIEDLNLLIEKLPEDYLKSIF
FT                   SQLKILGISEIKELGNPLELEKKFKFAKAINKSIKNSLCHNKSSIYLKGGRQNNLKDVE
FT                   VTIPKNQITVITGVSGSGKSSLAFDTIYEEGKRRYFENLGNGAKLSEQLQKPEFDLLQG
FT                   LTPTIAIEQKKGSQNPRSTVGTLTSIWDYLRMLFVSIGKSYCPYCKTPLEKKNNTKNYC
FT                   PHCQTIFSKINTSTFNANSHTGACHDCNGLGFTYQVNPQLIVKDPTISILDGATYYFGK
FT                   LRGKKPNGNWMVGELYAIAKDKNIDLDIPWNELPRDFIDAILYGTDDKIYEFSFESKGR
FT                   ESKIRRPASGAINHIQRLFRESSSENNTLHQYMNKIPCNTCGGELLCIEARFTTIKGYR
FT                   FPELTKMTIEQLWNWLCELPNQLQKNELSLVNDILTELKIRVSYLLKVGLSYISTDRTA
FT                   PTLSGGELQRVRLSSQLGSELVGLTYILDEPSIGLHPRDHNLIIKMIEELRDKGNTVIV
FT                   VEHDKDTILSADYIIDVGPNAGTKGGFIIAEGTTQEIIKNPNSITGKYLSTYNKISSQN
FT                   KIIPSKWLSLKGCHANNLKNIDVEIPLNCMCSITGVSGSGKSSLVFHSLLPALEEKLKQ
FT                   KSIPNKNYTALTGFDAIDDFILMDQTPIGKSSRSTPATYINIFDEIRSLFTETPQAKQK
FT                   LLDESYFSFNSKKGQCPNCQGLGKTKIILQYMADQWVTCNECQGKRYQKEILSIQYKGK
FT                   TIADILDMEVAEAKTFFSDCSDIYRKLSLLDEVGLGYLKLGQNTLGLSGGESQRIKLAK
FT                   ELGTKTKKRMLYILDEPTTGLHFKDIENLLITFRKLVNEQHSLLIIEHNTEVIRASDWI
FT                   IDIGPDSGINGGEIVASGTPDEIKINPNSITGHFI"
FT   CDS             262330..264564
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0205"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01813"
FT                   /db_xref="GOA:C9YI12"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI12"
FT                   /protein_id="CBE01813.1"
FT                   /translation="MKLSRYKKNSLVLSIILCSLIISILVITVFNTVKLHNISNKQSKN
FT                   YLNDVSTQIVMNVDSKIKFILSDLRIMADFIKQYEGDSRYEYLSKRKTSYKYYDVGIID
FT                   LEGKAEFLSGKKFDLKNTASYKKGIEGKEYSEVIESMGFVLYSVPIFNDNHEVSSILIG
FT                   VSNKESMDEILNIDSFNGEGTIEIINSQGKTLFIGKNNELIKDLSYKYKDSADEPWAQK
FT                   MLNDFKNDKSGNITITSSKGVQCLLTYHPITRGLNDWHFLLIVPEDVVLGELNKLNSFT
FT                   IIMTFITTCIIGIITLILYIIRRKYVNQIENIAYLDSITNGINSTKFSMLVKPLISESP
FT                   DSTYMMIAMNIKDFKLINDCFGSEKGNMTLKHLYNILYKNIDENEEFVCRHDADLFYLL
FT                   IKNRPVLEALELLYKIEADTNYFNKNRENPYFLRLSVGIYTIENHNEDLITIQDHANTA
FT                   RKSFNKTHQSDFSFYSDIERKRLISEKEISNLMEKALENKEFFMCLQPKIDIKSGKISG
FT                   AESLVRWKNSEKGIIYPSNFIPLFEKSGFICKLDLYILEETCKLISKWIKEGKEVLRIS
FT                   VNVSRQHLNDKLFLEKYKHICNKYNVPTCLIDLELTESIFLENPEAIDIIEDIHSNGFK
FT                   CSIDDFGFGYSSLGILKDFKVDIIKLDRSFFVSKNNIDRGKVVIKSIIELSKRLGMKVT
FT                   AEGIEELEQVEFLKNVGCDYIQGYVFSKPLLISDFENFAYENNKIKNIHY"
FT   CDS             264820..266850
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0206"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01815"
FT                   /db_xref="GOA:C9YI13"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI13"
FT                   /protein_id="CBE01815.1"
FT                   /translation="MISGRMLLIMNFLKGKNKTSYKDISKQLSIEERKVRYDINNLNIV
FT                   LRSLNKSVIQKMNKGVLIIPDDFQVVCINNNEYVFSLTERVSIMKIISMFKIDNLNLEK
FT                   LSKEFQVSRSSIKNDLNVLSSELERNQITITYDKSFKISGEEDLIYKQRLNILKSYSYL
FT                   FGKEKSDLSVFEKYLVNVIEKIFKGIYLIDIYNWSMNLLLQMGWTLNDESFTWYVSNIF
FT                   LFTWYIHSDEKHPLESASLSEPCFENKFDQEFETIIQKKLTKEQIFLLKSFVFFTNKYA
FT                   SLNEDMDLISTEIIVQDLIYNMSEILEISFKEDMILYKGLLNHIAPLIERIKQNIQIYE
FT                   ELLHVIPDKYQYVLEATKVSIQKNRVLSQIKNENEIILLAIHFLGSIHRNERNNYKNIL
FT                   LVCGFGYGVIAMLKDSLVNDYQINIVESIPSYKLQDYKEWESIDFIITTSKIVIDLPKT
FT                   IIEINPFLQEEDYLKFEEKGIKRKNVLTNYMSIKKRLDFLEEDAQKRVLSIICQELGYS
FT                   DERILFRQLNLSDLIGIDTIRIIDEDMKWEDAVKISSNILANCDFVSAQYAENIIDILK
FT                   NVGFYAVKDNEFALLHGNDSSLVKVSSISLLICKEAVSFGDKKVKIIFCLASRDKKEQI
FT                   PAIINLTKMVYKTNFIAMLESAKTKEEAEVLIHKYEKEVTV"
FT   CDS             266847..267299
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0207"
FT                   /product="PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01816"
FT                   /db_xref="GOA:C9YI14"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI14"
FT                   /protein_id="CBE01816.1"
FT                   /translation="MNKLVNVKCSFKIHANSKEEAIVSLVDVVSKEGYLIDKNQFLEDV
FT                   LKREETLSTYIGHGIGLPHSQSVGVKNSCITIGKLDIPIEWTEEGEKVDLIFLISVTKD
FT                   NENNLHLKILSKLARLLMHESFRNQIRCSDEQTVYNLIKEKIEEED"
FT   CDS             267301..268356
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0208"
FT                   /product="PTS system, IIc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01818"
FT                   /db_xref="GOA:C9YI15"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI15"
FT                   /protein_id="CBE01818.1"
FT                   /translation="MRILKFLQKHLMTATSYMIPFVVAGGILFALSVTLSGQAAVPETG
FT                   WLAKLNQIGAAGLALFIPILGGYIAFSMADKPGLAPGMIGAYLAKEVNAGFIGGIIAGF
FT                   IAGFVVLQLKKIKLAPTMRTLGSIFIYPLIGTLITGGIIVFLIGEPIASFMTWMTNWLN
FT                   GMSGVSKIPLGGILGGMIASDMGGPINKVAATFAQTQVDTLPYLMGGVGVAICIPPIGL
FT                   GLATLLFPKKFSKEERDSGKASLLMGCVGITEGAIPFATSDPVRVIPCIMAGSIIGNIM
FT                   AFLLGCLNHAPWGGLIVLPVVDNRLGYIASVLTGAVVVAVLMKLVKKDVKEDEEIEEDL
FT                   DESIELIFEEL"
FT   CDS             268423..268731
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0209"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01820"
FT                   /db_xref="GOA:C9YI16"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI16"
FT                   /protein_id="CBE01820.1"
FT                   /translation="MKIVAVTSCPSGVAHTYMSAESLELSAKKFGIEIKVETQGSSGID
FT                   NELSLKDIDEATCVILTNDVEIRNMERFKGKKVVRMSVSEIIKKSDALIKKIKDTFQ"
FT   CDS             268835..270100
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0210"
FT                   /product="putative sugar-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01822"
FT                   /db_xref="GOA:C9YI17"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI17"
FT                   /protein_id="CBE01822.1"
FT                   /translation="MKKLPIKTVVQRLLDLQEEGKSATLLGIGPMSPNLLQASFELAKD
FT                   DDFPLMFIASRNQVDADELGGGYVNGWNQETFTKDIKKIADKVGFDGLYYLCRDHGGPW
FT                   QRDKERNDHLSVDEAMELGKKSYLADIEAGFDLLMIDPTKDPFEIGKVIPLDVVLERTV
FT                   ELIEYCENERKRLNLPDIGYEVGTEETNGGLTSTETYETFITRLKVELDNRGLPMPTFI
FT                   VGQTGTLTRKTEQVGTFNFRNAYDLAQMAKKYGVGLKEHNGDYLDDVTLLEHIPSQIIA
FT                   TNVAPQYGTEETRAYLKLAEVECKLEKEGLVDKTSNIRHVLLVNAIECGRWRKWVVGEQ
FT                   KNLTTEEIFKNEVLSNEILDIAGHYTFNNDDVKKEIEVLYDNLSKNNIDGQRFVVDHIK
FT                   RPLRDYAECYNLKGVTTRILNK"
FT   CDS             270188..270904
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0211"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01823"
FT                   /db_xref="GOA:C9YI18"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI18"
FT                   /protein_id="CBE01823.1"
FT                   /translation="MINLIFDVDDTLYNQLTPFYTAYNKVFSSIKDISIEDLYMSSRKY
FT                   SDEVFHMTENGEMPIKEMHIYRIMKAFEELGNSITEKDAQSFQDEYIYQQSQITLIPEV
FT                   ERILNFSKERNINLGIITNGPSNHQRMKLKQLNIENWVDKSNIFISSEVGFSKPDTNIF
FT                   RVAENVMNLDRENTYYVGDSYRNDVLGAKKAGWKSIWLNHRGHEVEELFYKPDFVILEH
FT                   KDLISLFIKICSYKNM"
FT   CDS             complement(271099..271392)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0212"
FT                   /product="putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01825"
FT                   /db_xref="GOA:C9YI19"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI19"
FT                   /protein_id="CBE01825.1"
FT                   /translation="MRNMIENLIKNNTYIDDKVIMLSMLSSAKASANMYLNSALTSSTP
FT                   ELRAIYSASLTQMVEGHTALTELSINKGWVKPYDKPIQQLTCSYKESQNVID"
FT   CDS             complement(271398..271613)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01827"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI20"
FT                   /protein_id="CBE01827.1"
FT                   /translation="MRTLSETEKISLAAVIKMESDGLLMQRAINMLISDEDLKRQSESS
FT                   ILATEGRIKAIQQFIVENEILISEEV"
FT   CDS             complement(272158..272670)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0214"
FT                   /product="putative nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01828"
FT                   /db_xref="GOA:C9YI21"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI21"
FT                   /protein_id="CBE01828.1"
FT                   /translation="MLEVIKNRRSIRTYIDKNIEEDKITEILKSAMQAPSSKNAQPWEF
FT                   IIVDDKELLKELSKSQHRAKHIEFAPLCIVVLGNRDKFLKPGKWIQDLGACTQNLLLEV
FT                   TNQGLAACWAGVFPKNKVVNKVKQILDLPVKLVPYALISIGYSEEKNEFIDRFDENKIH
FT                   RNVYKNR"
FT   CDS             273120..273596
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CDR20291_0215"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01830"
FT                   /db_xref="GOA:C9YI22"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI22"
FT                   /protein_id="CBE01830.1"
FT                   /translation="MKVAVVMGSKSDYPKLEEGIKLLEKYGIEVVARALSAHRTPEQLS
FT                   IFLKEIEDDTDVIIAAAGKAAHLPGVIASQTLIPVIGLPIKSSTMDGLDSLLSIVQMPK
FT                   GIPVATVTIDLGLNAALLALQIMTLKYPKLKEDLKSYREEMAQKVLEDDKNLRG"
FT   CDS             273602..274300
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="CDR20291_0216"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01832"
FT                   /db_xref="GOA:C9YI23"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI23"
FT                   /protein_id="CBE01832.1"
FT                   /translation="MLLYEGKAKQVYSTDNENEYVVYYKDDATAFNGEKKAEISSKGIL
FT                   NNKISTIIFEMLKENNINTHFIKSLSDREMLVKKVEILPLEVIVRNIAAGSICKRVGLE
FT                   EGVVFDEPIFEISYKNDAYGDPMLNDDYAVAMKLATREELKFLREETLKINELLKAFFL
FT                   KLNLKLVDFKIEFGKDSEGNIILADEVSPDTCRLWDVNTNEKLDKDRFRKDLGDLVEGY
FT                   TEVLSRMNNK"
FT   CDS             274312..275679
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="CDR20291_0217"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01833"
FT                   /db_xref="GOA:C9YI24"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI24"
FT                   /protein_id="CBE01833.1"
FT                   /translation="MCGVLGIYSNKDVTKELYYSLYSMQHRGQESCGLALLDDGEIKYK
FT                   KDMGLVGDVFKENELSKLKGNIGIGHVRYSTAGGSHVSNCQPLVGSCRKRQLAIAHNGN
FT                   LVNANYLKDMLEEDGYMFQTNSDTEVILYILARYYKGDIVESLKVTMDYIKGAYALVIM
FT                   SQEELVAVRDPHGFRPLVLGKKGDEYIFASENCAIDILGGEVIRDVEPGEIIVVKDGEL
FT                   KSYFYSENYKPVKKSCIFEHIYFARNDATIDNVNAYEFRIKCGERLAQNETVKADMVVP
FT                   VPDSGWPGAIGYANASGLKISEGLVKNRYVGRTFIKPTQEEREIAVKIKLNPLSTIIKG
FT                   KSIILVDDSIVRGTTSKQLVKSLREAGAKEIHLRITSPPVAYSCYYGIDTPNRSKLIAS
FT                   SNNVEEMREYIGCDSLKFLDIEGMLDATEHKSTFCKACFDGEYPVKKIDKEELLSC"
FT   CDS             275673..276749
FT                   /transl_table=11
FT                   /gene="purG"
FT                   /locus_tag="CDR20291_0218"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01835"
FT                   /db_xref="GOA:C9YI25"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI25"
FT                   /protein_id="CBE01835.1"
FT                   /translation="MLTYKESGVDIDEGNRAVDLIKGKIKGTYDGNVVGDLGNFSGLYS
FT                   LKDFVGMKEPVLLASTDGVGTKLKIAQMMDKHDTVGIDLVAMCVNDLICQGAKPLFFLD
FT                   YIALGKLVPEHIEKIVGGIADGCKMSGCALIGGETAEMPGMYGEDDYDLAGFSVGIADK
FT                   EKIVSGNNVKSGDVLVGISSSGVHSNGFSFIRKIFLETYNYKMEQYVEELGMTVGEALL
FT                   TPTKIYVKLALDVLAKHDIKAIAHITGGGLIENITRVIPKGLGLDINKKSWEKPPIFKM
FT                   IEGFNAVDERELHKSFNMGIGLVLIVDKENADDVVNFINNRENDNAAYVDKKYSELLED
FT                   KAYIIGEVVDSHEGVELC"
FT   CDS             276743..277336
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="CDR20291_0219"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01837"
FT                   /db_xref="GOA:C9YI26"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI26"
FT                   /protein_id="CBE01837.1"
FT                   /translation="MLNIGVLISGGGTNLQAVIDGTESGEIKGQVKVVISSKQGAYGLE
FT                   RAKNHNIKAICETDEDKIIEILKENKIDLVVLAGYLKIISPKLVNEFRNKMINIHPSLI
FT                   PSFCGAGFYGEKVHQGVIDYGAKVTGATVHFVDEGADTGPIIMQDVVKVNQDDDAKTLA
FT                   KRVLEVEHRILKESISLFCENKLKLQGRRVFINE"
FT   CDS             277329..278861
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CDR20291_0220"
FT                   /product="bifunctional purine biosynthesis protein"
FT                   /note="includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase and IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01839"
FT                   /db_xref="GOA:C9YI27"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI27"
FT                   /protein_id="CBE01839.1"
FT                   /translation="MSKRALISVTDKTGVVEFAKELNKLDYEIISTGNTFKTLKENGVN
FT                   VMQVEDVTNFPEILDGRVKTLNPYIHGGILYKRDKESHVETVNEHKIHSIDLVAVNLYD
FT                   FEGTLKAGKSHDEIIENIDIGGPSMIRSAAKNYKDVIVVVDIKDYDSIIEKLKTDTMTL
FT                   EDRKKLSYKAFSTTGRYDALISSYFAGEVGDTYPDILNLTFQKEQTLRYGENPHQNGFL
FT                   YSQSNAKNPILNYEQLGGKELSFNNLNDLHGCLEVMREFKDSEEVVSVAIKHANSCGVG
FT                   LGKDAFEAYTKCYEADKVSIFGGIVGITSTIDKATAEKLNEIFLEIVVAYDFEPEALEV
FT                   LKQKKNLRILKLAKIEDSLQPYEMKYLDGKLLIQDRNNILAEKSENVTKAKPTDAQLKD
FT                   MEFGMRVVKNMKSNAIAIVKNGQTLALGCGQTSRIWALKNALENNKDKDFTGAVLASDA
FT                   FFPFDDCVTLAHEYGISAVVQPGGSIKDKDSIEACDKYDMVMVFTGIRHFKH"
FT   CDS             278872..280122
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="CDR20291_0221"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01841"
FT                   /db_xref="GOA:C9YI28"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI28"
FT                   /protein_id="CBE01841.1"
FT                   /translation="MKILVVGGGGREHAICWKLSKEKNVEKVYCAPGNAGITNVAECVN
FT                   IGDTNIEELLKFAKENEIGLTIVGPEVPLVMGIVDEFEKEGLRVFGPNKKCAQLEGSKA
FT                   FSKEFMIKHNIPTAKYKEYTNLEEAISEIDSFGYPVVIKADGLAAGKGVVIPENREDAI
FT                   ATLKEMMSDKKFGAAGDKIVIEEFLKGIETSILAFVDNDTIVPMASAKDHKKVNNYEQG
FT                   PNTGGMGTFSPSEIYTEELANKVKETVLEKTLEGFKKDGLNFKGILFVGLMITEDGEKV
FT                   LEYNVRFGDPETQSVLFRLETDLHEIMETILDNKLKDIEINYSDDEAVCVMLTSGGYPD
FT                   SYEKGKIITGLENLDDDIVVFHSGTKMLDGNLVTNGGRVIGITAKSTTVKDAAEKVYEN
FT                   IKKINFEGMHYRTDIGR"
FT   CDS             280147..283953
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="CDR20291_0222"
FT                   /product="formylglycinamidine ribonucleotide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01843"
FT                   /db_xref="GOA:C9YI29"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI29"
FT                   /protein_id="CBE01843.1"
FT                   /translation="MLNTENKDSMVRRVLVEKREGFDLEAKALKKDLVESLHIDNIENL
FT                   RILNRYDVEGISEEVYENAAKTIFSEPNLDVVYYEEIPKLNDERVFAIEFLPGQYDQRG
FT                   DWAAQCVQIVNQGIRPAINTAKVYILSGKITDEEFSKIKDYCINPVDSREASLEKPETL
FT                   KMETEIPTTVEVLDGFIDLDENGLRTFVSEKGLAMTLGDLQHVQKYFKDTEKRNPTITE
FT                   IKVLDTYWSDHCRHTTFMTEIENVKIEDGKFNDIVKEAYQMYLNSRDNVYVNRHKDICL
FT                   MDIATVAVKELKKNGKLNDLDESEEINACSINVDVEVDGKMEKYLVMFKNETHNHPTEI
FT                   EPFGGAATCLGGAIRDPLSGRSYVYQAMRVTGSADPRTTLEDTLPGKLMQRKITTEAAH
FT                   GYSSYGNQIGLTTGQVAEVYDENFVAKRMEIGAVIAAVPKENVVRERPEAGDVIVLLGG
FT                   KTGRDGCGGATGSSKEHSEESILTCSAEVQKGDAPNERKIQRFFRNKEVAQMIKRCNDF
FT                   GAGGVCVAIGEIADSLDINLDLVPKKYDGLDGTELAISESQERMAVAIKKENKDKFIQL
FT                   AVEENLEATHVATVTDTGYLRMFWNGKAIVDINREFLDTNGVKQTTDVHVTKVDEENTF
FT                   FSSNEIVKDVKCASMKDKFTKVLSDLNVCSQKGLVEMFDNTIGGNTVLMPFGGKYQATP
FT                   TQGMVAKIPVLGGETNTSTIMTYGYNPKVGKWSPFHGALYAVVESVCKLVAIGGNYSTT
FT                   RLTFQEYFEKLGNNPEKWGKPFSALLGAFYAQSKFEIPAIGGKDSMSGTFKDIEVPPTL
FT                   VSFAVDTVDAKKVVSPEFKKADSKVVMLCVNKAENDVVDFEELKRNLDKVRELIHGNKV
FT                   LSTYALGFAGVGEAISKMAFGNKIGFKFSEEAEKTFTDDKLFEASYGNIVLELANDDLC
FT                   MLEGYNYVVLGSTTKEASIFIKGEELALDELYKAHCSTLEPIFPTKTEEVKSKIETISY
FT                   ISQGEAKKSSLSIATPRVFIPAFPGTNCEYDSARAFERVGANANIRVFKNLTYKDIEDS
FT                   IDTIVNEIKSSQIIMLPGGFSAGDEPDGSGKFIATVFRNPRVQEAINEFLTQKDGLMLG
FT                   ICNGFQVLIKLGLVPYGEIRVPSESAPTLTYNNIGRHQAKIARTRISSNKSPWLAQTNV
FT                   GDIHNIAISHGEGKFVASEDVMRELIANGQVATQYVDFNNEATYDIEFNPNGSFYAVEG
FT                   ITSADGRVFGKMGHSERIGEEVFKNIIGEKDQKIFESGVKYFR"
FT   CDS             284159..285031
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0223"
FT                   /product="dtdp-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01844"
FT                   /db_xref="GOA:C9YI30"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI30"
FT                   /protein_id="CBE01844.1"
FT                   /translation="MKILITGSNGQLGKELVSQLEAINQSINQPKYVILATTRNDLDIS
FT                   NQTNIDNFILHNKPDVIVNCAAYTKVDACEDNIEIAYKINALGVRNLAIASEKVNAKLV
FT                   HISTDYVFNGFSKYPYREDNKTEPNSVYGKSKLMGEKFVEQFSHKYFILRTAWLYGNGN
FT                   NFVKTMIKLSLENKEVNVVNDQFGTPTSTVDLAKIIIRIMETEHYGVYHATCEGECSWY
FT                   DFAKKIFELKNIDIKVNPIKSNEFKCKAQRPLYSVLDNFMLKLIGLNSFRKWEESIEEY
FT                   LERYDINEK"
FT   CDS             285140..286021
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0224"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01846"
FT                   /db_xref="GOA:C9YI31"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI31"
FT                   /protein_id="CBE01846.1"
FT                   /translation="MKGIILAGGSGTRLYPITKCISKQTLPIYDKPMIYYPMSVLMLAG
FT                   IQDILIISTPRDIKAFEELFGDGSSLGLKITYAIQEKANGIAEAFIIGEEFIGNDRVSL
FT                   VLGDNIFYGYGFSERLENAVKRKGATIFGYHVSNPNSFGVVEFDKDFNVLSIEEKPTVP
FT                   KSNYAIPGLYFYDNDVVEIAKLVEPSDRGELEITSINSEYLKRGKLKVELLGRGMAWLD
FT                   TGTHKGLLDASNYVEVVQTRQGLYIACLEEIAYTKGYISREQLMKLAKPLIKTEYGQYL
FT                   LKLASEDMQYGR"
FT   CDS             286058..286615
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0225"
FT                   /product="dtdp-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01848"
FT                   /db_xref="GOA:C9YI32"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI32"
FT                   /protein_id="CBE01848.1"
FT                   /translation="MGKINVIKTKIEGLYIVEPNVFCDERGYFMESYNKKDFIEQGLDM
FT                   CFIQDNESSSRKGVLRGMHFQVRYPQGKLVRVTEGEVFDVAVDLRKDSQTFGKWEGVIL
FT                   SDKNKKQFYIPEGFAHGFLVLSEKAVFNYKCTNYYYPEFEHGFIWNDKQISIEWPLKGI
FT                   EEIFLSEKDKKQKSFKDICIRR"
FT   CDS             286653..287636
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0226"
FT                   /product="dtdp-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01850"
FT                   /db_xref="GOA:C9YI33"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI33"
FT                   /protein_id="CBE01850.1"
FT                   /translation="MKKILITGGAGFIGSNFVHYMLNKYVDYFIVNLDLLTYAGNLETL
FT                   IEIQDSSNYKFVKGDISNREQMYKLFEEERFDIVVNFAAESHVDRSVENPDLFIKTNII
FT                   GTQVLLDASIKYGVKRYHQISTDEVYGDLPIDRKDLFFTEQSPINPSSPYSASKASADL
FT                   LVSSYYRTYGLLTTISRCSNNYGPYHFPEKLIPLMILNALENKQLPVYGNGENVRDWLH
FT                   VYDHCTAIDLIIHKGNIGEIYNIGGHNERSNLEVVKMILNLLDKSEELISYVNDRPGHD
FT                   LRYAIDATKIENELGWKAKYDFDLGIKETVKWYIENESWWKAVLSV"
FT   CDS             287612..288343
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0227"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01852"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI34"
FT                   /protein_id="CBE01852.1"
FT                   /translation="MESCFISVTLKFIKFRKGRFILNEISSLINILALTQLSGSNTTNQ
FT                   CNCTYNSSSGFDMIMMTLLKALSQNNQQTSNGYNLSSNSENLFDELGSVVNNTASRFID
FT                   VDTKDKSVKSRIENAIEQASKKYNVDSNLIKAIIKVESDFNPNTVSSAGAKGLMQLMPE
FT                   NCRDLGVTDPFNIEQNIDAGTRHIKEYIDMFGGSIEMGLMAYNGGPGRMKSRGVESISD
FT                   LYKMPKETQNYIPKVMKYYRG"
FT   CDS             288352..288780
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01854"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI35"
FT                   /protein_id="CBE01854.1"
FT                   /translation="MGINIDKLNISPSINMEVKKLKESNKFSDKLNSLKQSSSLEDIKR
FT                   NLESVKKAGERLVLTQNYGDISIYKNAVKEYLKSVVDNMYSLDKNSSFWEHQYYKNVKI
FT                   VDSKLEDMTSKLISEEKENIDIVSTVDMIQGLLIDMYR"
FT   CDS             288804..289118
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CDR20291_0229"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01855"
FT                   /db_xref="GOA:C9YI36"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI36"
FT                   /protein_id="CBE01855.1"
FT                   /translation="MNSKKEDIYELNFGQLIEEKSGVIEENQNVFNAKVNVAVSIGNTT
FT                   ETIKNILDLKEGSIIKLSKNVDEKLDIYANDRLFAYGESIITNEKLSVRLSKIEDSDVN
FT                   "
FT   CDS             289270..289545
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="CDR20291_0230"
FT                   /product="negative regulator of flagellin synthesis
FT                   (anti-sigma-d factor)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01857"
FT                   /db_xref="GOA:C9YI37"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI37"
FT                   /protein_id="CBE01857.1"
FT                   /translation="MDIKNVSSNIVVNNYLKNTSGVKKVEEVKKINKTDKIELSKFAKE
FT                   MASVSNMSDENIRNKKVDEIKNALENGTYKIKPKEIAKKMIEDMRG"
FT   CDS             289550..289966
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0231"
FT                   /product="putative flagellar biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01859"
FT                   /db_xref="GOA:C9YI38"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI38"
FT                   /protein_id="CBE01859.1"
FT                   /translation="MITDLKVIIYEEKNIISKMMELLKEQFDYIVEKDLENLNMLNPKL
FT                   EDISRELASIEIKRRQLFGDDISMSEVVENSNDRYLKEIYTDLKHILALAKNQQESNDS
FT                   LIKKELIFTKKMINFIKPADKQTATYNSYGNIRK"
FT   CDS             289984..291294
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="CDR20291_0232"
FT                   /product="putative flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01861"
FT                   /db_xref="GOA:C9YI39"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI39"
FT                   /protein_id="CBE01861.1"
FT                   /translation="MAGLFSILNTANSGMNAHQKAIQTISHNISNLDTDGYSRQRTEFA
FT                   TNSPMYMPSLSNSIARGQLGTGVHVTDVTRARNSFYDYQFRAEAHKYGNTVSKYDYYNT
FT                   IETIINEPSDYGISAGIDDFFKGWESLAKDINSDSKKSLVVENASNLATLISESYKKLN
FT                   KLKGDIDDNINSEIKQINDMLKSLEDLNKSIDVISGSGSTPNDLLDERDRILDDLSFKL
FT                   DLENSDVKNMLSDGKLELNELKNADGTWKTGVSGTLQGLFEMHGKIDTYKSDLKDVSDG
FT                   LAKQINDVYNTSAGITVTDFFITSNVDGEDIIKVNPAIKSNPNELKLTADEASKIAKLK
FT                   DEKIDIGVAGGKVSTISDHYKAFAESVGLDSQKVNQDEVNQRKIINNIDNSRMSVSGVS
FT                   LDEEMTELIKIQRSYQASAKVMSTAVQLLDVVINGII"
FT   CDS             291313..292245
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="CDR20291_0233"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01863"
FT                   /db_xref="GOA:C9YI40"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI40"
FT                   /protein_id="CBE01863.1"
FT                   /translation="MRVSTGMMSSNYLNSLQDNLQRLDKVNRQVNTTKEINKLSDNPYK
FT                   AIKILNSKSEIKTMETYVENCKDTGNWLETTDTALDQLGKLLSDIKKTLVASGDGAYSD
FT                   DELKTLSNETNEKMKEIANALNATHEGKYIFSGSNTGVPPVECIDNADGSVSLKFNSSL
FT                   NLNKLNDSLSMDIAQGISVDYNVKLSSLGFDPTKTDPFEELNNISKKLANPDADAIKEL
FT                   TTTCLGDMEQLIENTVNVRSIYGTKANTVEAMKEKNDDSLIQLKDILSQNEEIDYGEKL
FT                   VQLKAAELTYQASLQTGGKLFNVSILDYI"
FT   CDS             292261..292653
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01865"
FT                   /db_xref="GOA:C9YI41"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI41"
FT                   /protein_id="CBE01865.1"
FT                   /translation="MMKVTLKKGILGFENLKEYELLDIEDNDSLKEFNSTEEEGIGFVV
FT                   VSPFEIINEYEIVLNQETIEKLEVKSPKDVVLFNIITLGQTFEESTVNMKAPIVINIKT
FT                   NFGMQIILQDDKYSIRHPLLRGDNGC"
FT   CDS             292647..292859
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="CDR20291_0235"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01866"
FT                   /db_xref="GOA:C9YI42"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI42"
FT                   /protein_id="CBE01866.1"
FT                   /translation="MLVISRKKDEAVLIGESIEVKIVGVDGNNVKLAISAPNNISILRK
FT                   EIYEKVKSENIKATNKNIKILKSLK"
FT   CDS             292881..293276
FT                   /transl_table=11
FT                   /gene="fliS1"
FT                   /locus_tag="CDR20291_0236"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01868"
FT                   /db_xref="GOA:C9YI43"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI43"
FT                   /protein_id="CBE01868.1"
FT                   /translation="MYGENPYNSYKQNAVFMASKEQLLLMLVDGAVKYTKIARAAILDK
FT                   NTQKAHRELVRVQDIFTELMVTLDQNAGQWAKDMYKVYDFVRYELSRANIRKDIQVIDN
FT                   VLPVIEQIKDTWHEADKKSKEERSRYK"
FT   CDS             293276..293632
FT                   /transl_table=11
FT                   /gene="fliS2"
FT                   /locus_tag="CDR20291_0237"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01870"
FT                   /db_xref="GOA:C9YI44"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI44"
FT                   /protein_id="CBE01870.1"
FT                   /translation="MELNLAELDKLSKEELLLMLVDGTVKYTNISKEALLNNDYLKAHN
FT                   ELIRVQNIFTELMTTLDQDAGQWAKDMYKVYEFIKSELAIADENKDIKIIDDILPIVKQ
FT                   IRDTWHEVYNQLKI"
FT   CDS             293653..295176
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="CDR20291_0238"
FT                   /product="flagellar cap protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01872"
FT                   /db_xref="GOA:C9YI45"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI45"
FT                   /protein_id="CBE01872.1"
FT                   /translation="MSSISPIRVTGLSGNFDMEGIIEASMIRDKEKVDKAKQEQQIVKW
FT                   KQEIYRNVIQESKDLYDKYLSVNSPNSIVSEKAYSSTRITSSDESIIVAKGSAGAEKIN
FT                   YQFAVSQMAEPAKFTIKLNSSEPIVRQFPPNASGASSLTIGDVNIPISEQDTTSTIVSK
FT                   INSLCADNDIKASYSEMTGELIISRKQTGSSSDINLKVIGNDNLAQQIANDNGITFAND
FT                   ASGNKVASVYGKNLEADVTDEHGRVTHISKEQNSFNIDNIDYNVNSKGTAKLTSVTDTE
FT                   EAVKNMQAFVDDYNKLMDKVYGLVTTKKPKDYPPLTDAQKEDMTTEEIEKWEKKAKEGI
FT                   LRNDDELRGFVEDIQSAFFGDGKNIIALRKLGINESENYNKKGQISFNADTFSKALIDD
FT                   SDKVYKTLAGYSSNYDDKGMFEKLKDIVYEYSGSSTSKLPKKAGIEKTASASENVYSKQ
FT                   IAEQERNISRLVEKMNDKEKRLYAKYSALESLLNQYSSQMNYFSQAQGN"
FT   CDS             295179..295514
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01874"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI46"
FT                   /protein_id="CBE01874.1"
FT                   /translation="MDKLKEKLNLYKDISLQIINLIEKEEYIKISSKLGERQEIINSVS
FT                   EIDRNDFIQLYNRMELIEIDSRIRDILQGQLLEVKKELHEYKLTKQVNTMYYNLNREKV
FT                   NIFNKKV"
FT   CDS             295529..296488
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="CDR20291_0240"
FT                   /product="flagellin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01876"
FT                   /db_xref="GOA:C9YI47"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI47"
FT                   /protein_id="CBE01876.1"
FT                   /translation="MSDYINEELIKKIKSRNDKDVNYTKEGKIMRVNTNVSALIANNQM
FT                   GRNVNAQSKSMEKLSSGVRIKRAADDAAGLAISEKMRAQIKGLDQAGRNVQDGISVVQT
FT                   AEGALEETGNILQRMRTLSVQSSNETNTAEERQKIADELLQLKDEVERISSSIEFNGKK
FT                   LLDGSSTEIRLQVGANFGTNVAGTTNNNNEIKVALVNTSSIMSKAGITSSTIASLNADG
FT                   TSGTDAAKQMVSSLDVALKELNTSRAKLGAQQNRLESTQNNLNNTIENVTAAESRIRDT
FT                   DVASEMVNLSKMNILVQASQSMLAQANQQPQGVLQLLG"
FT   CDS             296503..298722
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0241"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01877"
FT                   /db_xref="GOA:C9YI48"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI48"
FT                   /protein_id="CBE01877.1"
FT                   /translation="MDIEERVRLCFTPFFFYKYTFERKIYMLLSIVMIVKNEEKILEKT
FT                   LKSLTTLRSSIESELIIVDTGSTDDTINISRKYTENVYFHNWNNDFSSMRNISISYAKG
FT                   EWLLILDADEILIDSSTIVKFFKDGLDKKFNSASIQLKNLYSYDKKLYGYCSVLRLFKN
FT                   IDFRYHGKVHEQPIYKNPIFNNVADFEHYGYLFEDEEIRLNKVKRNEKLLFEELKENDN
FT                   SPYTNYQLGKNFIILGKYHEALYYLEKSYELYSKLESAPGYLITSLVKTYLYLGKHKKC
FT                   EKLCLKYIKKDMNNIDIYYYIAQAQVDLGKYENSIDSYKRYIYLLDNYEISTQANSLFS
FT                   DTDTVGLRDEAIITLIKIYYKLEKYESVISEYNNIEDMEKKKNVYFSLFMSLYKLNRFE
FT                   DIKNYYKEVSNSKIEKNSFYKNIEEVINNIKDDEKEHVYKILCDIEGNYGILNQIRINK
FT                   CVSIDKCKEILNEEKEIIYAYIIKVAFEDKIDLLDIFYEMEYVWIEKYLKYLLALERSF
FT                   NLVLYKYIISRPNTSDIKKIRVYKAISKVVLESISLSDEKYKEIFYLYIMYSYKYIRYI
FT                   YRNLSDFELIKFVCNDLDKFTIEFKHLLDIKNKVNDANEKLEYIHSMRKLLNEYPFYNK
FT                   IIKILISELEENIKESEEFKDLKDSFIISIENMIETGKINDAKSLVDDYSKTFMDDVKI
FT                   LNIKGILYMFENKLDKADFMLKKALSLDVENEDTIYNIEYLKSLR"
FT   CDS             298746..300623
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0242"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01879"
FT                   /db_xref="GOA:C9YI49"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI49"
FT                   /protein_id="CBE01879.1"
FT                   /translation="MNTPIVVNEKSKDIIKDWQYTYTNEDIKFTSIIILTYNQIEYTKL
FT                   CIESIRKFTPKNKYEIIIIDNNSSDGTVEWLKGQSDIKSVYNNKNLGFPKGCNQGIELA
FT                   TGENILLLNNDVIVTPNWLYNLNKALWSQDNIGAVGPITNACSYYQQIDVDYKSIEDMF
FT                   MFAHKINTSNINLWKYRLKLVGFCMLIKKSVLDNVGVLDELFTPGNFEDDDLSFRMLES
FT                   GYKLLLCQDTFIHHFGSVSFKENRNKYTDIMYINRRKFETKWGFNPEYSGMIRTDLISK
FT                   IDDSLEANINVLEIGCGIGATLLEIKNIYKNASIYGIEISESAGKLAKYSADVLIADIE
FT                   KVKLDYEKDFFDYIILGDVLEHLTDPWKIVNELKQYLKKDGCLISSIPNIMHVSVLRNL
FT                   VLGNFTYEDSGILDKTHLRFFTLNEITKMFNDSNYIINSVTATSMPLSEIDNRFIDTMC
FT                   KESCKEMRQQYESYQYIVKATKSIDTKRYSSISMVNLKYALMRIDNELDVDSNLSYIFD
FT                   NYNITEPCFVDDIEYLVDTFVINKATLLNRLGVEAFNRGLGDFSINMFMTVLEMDRDDI
FT                   DSIYNITSVLCELEEFDTAYNLIKNSSKKVQSESDIQDILYFIEGKRYE"
FT   CDS             300616..302730
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0243"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01881"
FT                   /db_xref="GOA:C9YI50"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI50"
FT                   /protein_id="CBE01881.1"
FT                   /translation="MNNDKICFITCVNDERLYEECLVYINSLDIPKNFSIETVALRGAD
FT                   SIASAYNKAMRETDSKYKVYLHQDAFIINKNFIYDILEIFKKNTDVGMIGVAGVKDIPV
FT                   NGIWWDSDKKAGKVYDSHTGKMDIYEFSNFEECFNEVMAIDGLIMITQYDVFWREDKFD
FT                   GWHFYDLSQSMEFRQNKYKVIVPKQNKPWCMHDSGVANINNGYDEYRIKFVKEYINLDL
FT                   YRENFYEFDKKKASTILKSNKHVMDCMKEELTEQLRLKNYKDVLDIVSKIAHFSVFNHT
FT                   GLYSCEKCERALLECANNLPEIENTKLFTKKDLKRRKVLHVLSEGYSTGGHTRLVKNWI
FT                   EIDKDSVHSVVTTWQSDTLPDWLLKAIDDSGGEVISLDLISDDYLKRAVALRKIAYDWA
FT                   DIVILYVHMWDTIPVVAFGVDGKIPILHVNHYDSTFWLGTSIADIVIDFSEASQLITLD
FT                   KRGIDKSEILPMPLKEKEVFSKSEVRKRYNLEDDVTIILTIASERKYNSVNDINYFKIA
FT                   KTLIENTDNTIIIVVGVDTENLYWKTLSNVTDNRVICFGTTANIDDFYKISDIYLESFM
FT                   VGSHTSKLDAILYDLIPVKFKNEVSPIFTNMWNFIDKFDYKNIKEVIDMIRRYNTSEFD
FT                   RDKIKEKQSEIKHFVIDKHCIEIKNYIDKIYKEANHHKVKYDLYKNDEIEDYQLFVALY
FT                   GYMVKNKNMS"
FT   CDS             302739..303734
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0244"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01883"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI51"
FT                   /protein_id="CBE01883.1"
FT                   /translation="MNNIHINKFEKSCEKNWDYFVENKSINGTFLQTRNFLNYHEEGKF
FT                   TDHSLIIYKGEEILAVVPACETYENGERVFFSHLGSTFGGIIIRSGFNDIRHVNAITNK
FT                   LETYLQEQSFNKVYLKNTSRIFCKEDTSLLEYFLFKNNYMFYDELSMFLELSKYKKDIL
FT                   ANFRYSKRRYFKYSLKNNLTFKRLYSDEDIVCFFNLLSNCLDSKGAKVIHSVEELLEFK
FT                   NNRLKDIVEFYAVYIDDIMICGSMVFNFQERVYHTQYLASNSTYNKYYPMIFLYYNLIK
FT                   DALERNFKYLSFGISTLNRGKYLDEGLATFKEGFGSSAICNRTYYKNINK"
FT   CDS             303826..305058
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0245"
FT                   /product="putative carbamoyl-phosphate-synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01884"
FT                   /db_xref="GOA:C9YI52"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI52"
FT                   /protein_id="CBE01884.1"
FT                   /translation="MKRLMILGSIKYFENIVMSAKKEGIYTIVCDNRIDTPAKKICDEA
FT                   IDVDVFDFDKIKSIAIDKKIDGILTGFTDSLMKPYVYIANELNLPCVISCNQLESVTNK
FT                   AIMKKYFKNNAIPTTDYCIIESLKDLEKIQGLNFPLVIKPVDGYGSRGVYFVSNIEELI
FT                   EKFEYSKEASQDGQVIIEEFYESEEIQGLAWVHNGESHVFYIGDRELVNIHTGRAGKPD
FT                   RLLYPSKYCFQYEEEIKSIYQNITQAFDIKNGPLYVQMLVGAYGIKVSEVMPRLPGGCD
FT                   YMAISQITDLDIGSLFANFSVNNEVNFDEIKKYNMHLSKCVYALPIYIRPGTIKKINNI
FT                   DKIENLDYVTQFLLLVKEGDTIGLYEDERQDCGRVYGIANNIFDANIKKKCIHEMIEIF
FT                   DENNENMIENF"
FT   CDS             305069..306022
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0246"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01886"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI53"
FT                   /protein_id="CBE01886.1"
FT                   /translation="MIDMKLITHEQIMSLNISQKQGYEWIKESFLTKKDCQLPPKISMV
FT                   EEGHVFYNVMPSLNHNHMIGGIKMVTRLPGRNPSLNSDIFLYNMKDAKLKAILDGNYIT
FT                   AFRTAAVAGLAIDTFAKKDFNTISIMGLGVTASAIMNMLSYTLKDKNINIKLLKYKDQA
FT                   ESFIKKYEKNEQFSFEICDTHEELIVDSDVVISTVTYTDEYLSEFKWFKKGALLLPVHV
FT                   MGFGNVDYLFDKVYLDDYNHLKHLENIDRYKYSCEFYNVLSKQAKGRENDDERIISYNI
FT                   GLSIHDILFANKIYELCETLNCEEIELKEPKEKYWI"
FT   CDS             306601..307701
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0247"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01888"
FT                   /db_xref="GOA:C9YI54"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI54"
FT                   /protein_id="CBE01888.1"
FT                   /translation="MNLLLVKFNNLLKQFQTHKEEYEQKIKDVMESGYYILGNEVRHFE
FT                   EEFASYVGSKYCVGLASGLDALIIAFRALGISEGDEVIVQSNTYIASVMGISINGATPV
FT                   FVEPNEYYNIDSSKIEEKINSKTKAILVVHLYGQASKMKDIQELCDKYNLYLIEDCAQS
FT                   HGAKYDGKMTGTFGDIGCFSFYPSKNLGAFGDAGAIVTSNEEIADKVKILRNYGSEKRY
FT                   YNKFVGYNSRLDEIQAGLLRVKLKYLNEIEIEKSKIVDRYLNEINNPKVILPKIENNCT
FT                   HVWHLFVLQVEKRDTFMEYLKKNGIESIIHYPIPPHLSEAYAYLGYKKGSFNIAENYSD
FT                   KVVSIPLFVGMEDEEVSYIIKIINEY"
FT   CDS             308507..308824
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="CDR20291_0248"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01890"
FT                   /db_xref="GOA:C9YI55"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI55"
FT                   /protein_id="CBE01890.1"
FT                   /translation="MNTYDIIKMGLDATNLRSQTIANNIANINTEGYKRHYVTFEETLN
FT                   DAMPKIEEKTDNSKGLRVDGNNVDIEEEKVNQAMATLQYNALISFANGKIAMTKSIISG
FT                   R"
FT   CDS             308850..309236
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="CDR20291_0249"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01891"
FT                   /db_xref="GOA:C9YI56"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI56"
FT                   /protein_id="CBE01891.1"
FT                   /translation="MRISASGLTAESLKMDIISSNVANINATRGPNGEAYRRKVVSFEE
FT                   NYDNKLGMLGVKVTSVEDDKSPLKEVYDPSHPDAKPNGYVEYPNVNILVEMTDLITASR
FT                   AYDSNVDTLNAQKSMISKALEIGK"
FT   CDS             309246..309563
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="CDR20291_0250"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01893"
FT                   /db_xref="GOA:C9YI57"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI57"
FT                   /protein_id="CBE01893.1"
FT                   /translation="MPITQINNLMQGAKLDNLIGETKPLTLNNKEEKKNFEDVIIDTID
FT                   KVNFQQVTADDMKEKFIKGEDVSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNKVQ
FT                   I"
FT   CDS             309588..311138
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="CDR20291_0251"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01895"
FT                   /db_xref="GOA:C9YI58"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI58"
FT                   /protein_id="CBE01895.1"
FT                   /translation="MIASFKNKIKEQVAKSRTKISSLKKGTKIALGIGVIAICLALVFT
FT                   AISASKNKYAVLFSELDVQDAADISAELESKKIDTKVKGSTIYVPRTEVDKLRLELAPS
FT                   LTGGSKGFALMDDSSSIGLTDEEFQIKKQRMIQGEIEKTIKSFPQVEDTRVHITFGESS
FT                   VFEKEAIPGSAAVYLMLKPGTTLEKNQIKSVMALISGSVTNIPEKNVQVIDNKMNLLSE
FT                   GILEDEDVDENNQPTNSLINVDKNKASEQALNKQLEKSILEMLEPIFGKGKVKATVNAD
FT                   LSFDTAEKTEIKIDPDKVAIKETRSKNSSKSATNNVQGVDANMNNQGNNNGTNTEDSLD
FT                   ESFEYETGKIETHTIVAPGELNRLTASVAIDGKIAKGVQADVEDIVNNAIGMDGARGDT
FT                   LSVVSMVFDPEGKAEAKQELEEIKKEGFKKNIIKAVIGVVAVVAIGAIGYLIYKKRSER
FT                   EDMDYEDEDYISKSDSVDRKDNPLLGDDPELTLEEAVKMYAEEKPDQVTEIIKTWLNE"
FT   CDS             311151..312221
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="CDR20291_0252"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01896"
FT                   /db_xref="GOA:C9YI59"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI59"
FT                   /protein_id="CBE01896.1"
FT                   /translation="MSTEITNVNAFDLSDINESDKKEKIEGEGLKKAAVLLMTLGPNVS
FT                   SDIIKSLPDKQVQKIGLEIANISSIASKERREILKEFVEINRAKDYVIEGGLEYARELL
FT                   SNALGNAKANKLLEGISINTSTKPFKHIIKLDVKKILEILRDESAQTIAVLLAHMEPEN
FT                   GAEVLSYLDFDLQNEVAMRISSMGSISPEVIKVIESSLEDKLHSISGDDFKDYGGVSTL
FT                   VQILINSDRKTEKNILGTIEEQDPALAAQIKSHIFVFEDIVKLDDISIQKVLKEVTMKD
FT                   LVYALKGVDDEISDAIYRNQSSRAADALKEEMEMVGVIKVTQVEAAQQKIANIVRKLER
FT                   EGAITIVRNFGGDFVE"
FT   CDS             312202..312945
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="CDR20291_0253"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01898"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI60"
FT                   /protein_id="CBE01898.1"
FT                   /translation="MVTLLNNKIIKSKKASYKGVLDLTIIDKVRVGESNVNKENDCRFR
FT                   DEVIKEAIESAEIKKNEILEEAKMNAQNIEKQAYEKGYSQGQKNGYEDGYKESYDEYTQ
FT                   KAKDEADFIKNQADLILLQANEKMTEYIKEKNKEIVRLAINMASSVLKKHFEDEESMSD
FT                   LLKQIIQDYEGSSSFIVRCNSFYKDNIEKEFELFKEETSLKSSVFVIADDSIDKGNAII
FT                   QKENGRIIVGIDCAMEKLKEELLGE"
FT   CDS             312949..314268
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="CDR20291_0254"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01900"
FT                   /db_xref="GOA:C9YI61"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022425"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI61"
FT                   /protein_id="CBE01900.1"
FT                   /translation="MYKTDISIDFDKINKKIENLELTISEGRVKKIIGLTVEVEGIKAF
FT                   VGELCVIYNQVNKPVNCEVVGFKDKEVILMALGELTLIAPGCKVISKGIPLSVMCSDNL
FT                   LGKVLDGLGNPIDNSDAVLGDRYNLNNEPPDPMKRKKIRNIMETGVRAIDAFTTCGEGQ
FT                   RIGIFAGSGVGKSTTLGMIARNAKADVNVIALIGERGREVLDFIDKDLGEEGMKKSVVV
FT                   CATSDKAPLVRLKGALTATAIAEYFRDQGKKVILMMDSVTRFAMAQREVGIAIGEPPAQ
FT                   KGYTPSVFAILPKLMERTGTSDKGSITAFYTVLVDGDDFNEPIADTTRGILDGHIVLSR
FT                   DLANKNHYPSIDVLNSLSRLMNEIASKEDIKIASFARDMLAEYREAEDLINIGAYASGT
FT                   NKKIDEAIYYHEHIINFLKQGINEKSSFNETISSLRRIFE"
FT   CDS             314300..314746
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="CDR20291_0255"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01901"
FT                   /db_xref="GOA:C9YI62"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI62"
FT                   /protein_id="CBE01901.1"
FT                   /translation="MELDKNFKFRLQKVLDLKIKDEEEIKMEFAKIQQKKIDIESNLEN
FT                   LESNYSKYSISKNNDSVQNQKITINYLLALNNSIMDLSEELDKSTNELEKARKQLISKQ
FT                   IERKSLEKLKEKKYGQYYKEEQLKEQSTNDEFASMSYLRNRQVL"
FT   CDS             314774..315979
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="CDR20291_0256"
FT                   /product="putative flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01903"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI63"
FT                   /protein_id="CBE01903.1"
FT                   /translation="MKIQADSYNIIKDIGNRKSSSKNKNIKNNKFEDNLYKATDHKKVK
FT                   DRRETSKQNVSSDKRENSDNECHLDEDKSNHLEDENTYEKDCSNNNEALHQLLNLLKDN
FT                   YKKDKDINTILNNLKKLSISDELKQELKLNKNILNKIANQNLELNRASTNNPNDIENLD
FT                   IMKLRELLENNASEDIEVISKTTENDTKSIDLYSFDSNRIDTLNSNKQKDDSSDILEKL
FT                   AGVNGNKSGNFGQVINKSVDMNKIKNDNVNLKQIESNVMDDSIKAIKHMKTNDIQELTI
FT                   KLRPKELGDMNIQLLKDGESMRAVVTVFNKDVFDSINKNIADLKQHLELTNVNIKDVSV
FT                   QMHSDNTNTSDTFDKAFEQQNRQNNQENMSKQNTNDKRNNVVIEDEIKENIIDDDRVDL
FT                   LA"
FT   CDS             315997..316605
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="CDR20291_0257"
FT                   /product="putative basal-body rod modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01905"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI64"
FT                   /protein_id="CBE01905.1"
FT                   /translation="MYGIATALAGTQVNYRSNNLSQLERNINDIANKQVRSKGNQTVTD
FT                   NGTPIIGQGDDADKDLFMKILVAQMGNQDPMNPQDPTEYVSQLAQFATLEKMSAMNDKL
FT                   DILLALSNSTLINSALSMATSLIGKEVEVSGEEEEDENIVGVVKSTYIKDGEVHLELEV
FT                   DGSDKTVGVKYEKLLKIGEVDANSGEENDSSEQESPEEV"
FT   CDS             316632..317615
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="CDR20291_0258"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01907"
FT                   /db_xref="GOA:C9YI65"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI65"
FT                   /protein_id="CBE01907.1"
FT                   /translation="MIKAMYSGVSGMKANQTKLDVIGNNVANAGTTSFKKSSARITDSF
FT                   YQTVLYASAPTAALGGTNLGQVGVGSKISSINKDMTQGNVQPTNRPSDLMIDGDGYLPV
FT                   VRQGTVMYTRDGSFNLDTGFKAADGALKNIKGGRLVNGDGYMLQGVIYDGEYKADTGEF
FT                   IKKGDAKGKEPIVIPLQSISPKDGTVQNVLEYNISKDGTVEFLLSDGQRTQFVYDIPDG
FT                   AKVGDTPAGIDKLKGTIQKVQTYAFQNPAGLDAEGGNLFKPSANSGDPQIAGATGNIIQ
FT                   GAIEASNVDIAEEFTEMIIASRSFQANSKIISTSDEILQEIINLKR"
FT   CDS             317628..317831
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0259"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01909"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI66"
FT                   /protein_id="CBE01909.1"
FT                   /translation="MIRVTDLNGRRYILNSDLIVRIDSVPESRILLTTGEKNLVKESVD
FT                   EIVDKVIKYKRKVNVGYIRSEK"
FT   CDS             317831..318649
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="CDR20291_0260"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01910"
FT                   /db_xref="GOA:C9YI67"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI67"
FT                   /protein_id="CBE01910.1"
FT                   /translation="MKKTDSLTFIGLILSTVLVLFGAVKGSSSGLKSFFDFASILITVF
FT                   GSFGALMITFTIDDIKLIKDALQYSFKTMNISKLDLLNQFKTLSKKARREGLLSIESDV
FT                   MKIQDPFMKKGLELCIDGLEVNEIRSILELEIDSVEETNNRYSKLFKTWGTFAPAFGML
FT                   GTLIGLIQMLSDLTSPDLIASGMGKALITTFYGSLLANIALNPIAYNIDEKTEKEIYVK
FT                   EMMLEGIISIQSGESSIVVEERLATYLSNNEKLEIMKSNKNTERAMSNGA"
FT   CDS             318639..319334
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="CDR20291_0261"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01912"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI68"
FT                   /protein_id="CBE01912.1"
FT                   /translation="MARKKNKKKDEINPDAWLATYADTITLILTFFVLLYATSVVDMEK
FT                   FKNIADALKGQFSGISMFSTGSSTSEKSPIESVLVDKNDKSNLEQDLKDKVNNSNLQNS
FT                   VTVKDDSRGILLELDDSILFDSGISELKADSKATLNKVYDMIKMMKNKIVIEGHTDNVP
FT                   VKSSTHESNWDLSSSRAVSVVRYFVEEKGMDPRLFSATGCGEYQPLVSNETAKGRAENR
FT                   RVNILITID"
FT   CDS             319346..319789
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="CDR20291_0262"
FT                   /product="flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01914"
FT                   /db_xref="GOA:C9YI69"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI69"
FT                   /protein_id="CBE01914.1"
FT                   /translation="MFKNKKIIIIILILIIFSAGAGFFILGEGGNKQIDKIAGLFIPTG
FT                   KGKDEVKTENLDLEEMVLKLADEGVRYLKVSITVSYDSSYKDIEKNTPLIRDNIINCFM
FT                   AKRADDFTADNLKNIKEEIKNTLNIQLGENVIQNIYFTNIVVQ"
FT   CDS             319804..320178
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0263"
FT                   /product="putative flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01916"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI70"
FT                   /protein_id="CBE01916.1"
FT                   /translation="MILYLLKILICIPIILILIVLSLKISQGTLLKKYNDKYIKILDIV
FT                   NISKNNSIIILKIGEEGCIMASSSSSMNKIKDLTKEEILRIENDIKERNFKIQDFKMER
FT                   IKKKYDFSRYIGKFTKKEDK"
FT   CDS             320179..320844
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="CDR20291_0264"
FT                   /product="flagellar biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01917"
FT                   /db_xref="GOA:C9YI71"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI71"
FT                   /protein_id="CBE01917.1"
FT                   /translation="MELLSKLPLADVPYTSSMQLFLFLTALMFLPFVMFMMTSFVRIVI
FT                   SLSFLKSALGAQQAIPSQILVGLAIVLTIFIMRPVLNEINEKALQPYMKEEVTMEEAMK
FT                   EAEGPIKEFLLKQTRQTDLDLFVEQAGLKEKKLTRENIPLSVVVPAFAISELKTAFQIG
FT                   FLIYIPFLIIDLVVASVLMSMGMFMLPPVMISLPFKLLLFVMVDGWNLIVKTLILGFG"
FT   CDS             320857..321126
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="CDR20291_0265"
FT                   /product="flagellar export protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01919"
FT                   /db_xref="GOA:C9YI72"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI72"
FT                   /protein_id="CBE01919.1"
FT                   /translation="MSEFMIMSVLKNGMFTGAMIAAPVLIVSLVVGLLISVFQATTQIQ
FT                   EQTLTFVPKLIAILLVVAIGGSWMLHTLISFTSEIFNMMSLITK"
FT   CDS             321138..322952
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="CDR20291_0266"
FT                   /product="flagellar export protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01921"
FT                   /db_xref="GOA:C9YI73"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI73"
FT                   /protein_id="CBE01921.1"
FT                   /translation="MIFVFIRIVAFFGTLRILFPAGTPALFKSLFAIIISILISSTMQI
FT                   EYATNIDNIVLFTLYGINETITGIMLGYITNLCFYSIRMAGSMMDQQMGLSMINMFDPN
FT                   SMTQTTLIDNLMNWTARMIFFSMDGHHVLIRGIRYSFELIPIGKSFVDNNIDYIINIFV
FT                   QCFLTGFKIAIPIVLCLLMADFILGLISRSVPQLNVMIIGMPLKILVGIALFIISIPLI
FT                   VNQISHLLSQIPKMYEGTFALAPMFFMGSTDKTEEATPKKKGEQRKKGNIAKSKELPVA
FT                   MTLLAFTLLVPTLFSYVVDTLKSSLNYFLSLDFYMNINYSSIEKLVIAGLMDFFKIFLP
FT                   IAIPFLVLGIVANLFQVGILFTGETLKPNLSKLNPVSGFKNMFSMRSLSTLIKDTAIIS
FT                   ILAYIGYTFFQDNYLDILKLGNIYLPTLMYTVKDLVYSILSKICVAMIVIAVADYVYQR
FT                   YSHKKQLRMTKQEVKDEYKNSEGDPEIKAKIKQKQRQISSQRTMQAVPSATVIVTNPTH
FT                   LSIAVRYEKGKDQAPVVVAKGADYLAFKIREIAKGNDIPIIENKPIARLLYKQVEIDQE
FT                   IPEDMYQAFAEILVAVYKIKNRYKVLKR"
FT   CDS             322961..325036
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="CDR20291_0267"
FT                   /product="flagellar export protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01922"
FT                   /db_xref="GOA:C9YI74"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI74"
FT                   /protein_id="CBE01922.1"
FT                   /translation="MNKFNLKENMDVIVAFGVVGIVLMMIVPLPTFILDILLAINISLS
FT                   VLILLMTLFTTNVLDLSIFPTVLLVTTLFRLGLNLSSTRLILTQGYAGEVIEAFGSFVV
FT                   GGNYVVGIIIFLIILIVQFVVITNGSGRVSEVTARFTLDAMPGKQMSIDADLNAGVIDD
FT                   KTARKRRKELQQEADFYGSMDGANKFVKGDAIAGLIVTAINIIGGIVIGAVMLNMTLMG
FT                   AAQTYVRLTIGDGLVSQIPALLISTSAGIIVTRASTDENFGGLVSKQLTAIPKAVMMTG
FT                   CVLIVLGMMPGLPKPAFFSLGIGAIAAGYFLGREKKDTLEDLEFEKPDMVNPDKNEVED
FT                   VTNLINVESIEVEIGYGLISLADESAGGDLLQRIASIRRQCAIDMGIVVQPIRIRDNLQ
FT                   LNPNQYNIKIKGNVVGGYEIMPNMVLCMDPMNQGFSIFGIKTIEPTFGIEALWIESDKV
FT                   EDAEIKGYTVVDSSTILITHLLDIIKSNAHELLGRQEVKTIIDAARENYSAVVDELIPD
FT                   LMTLGEIQKVLKNLLREKVNIKDRVTILETLADQSRNTKDIELLTEYVRIALARSICNN
FT                   LVDDDKTIVVATLSPETEELVSNNLQRSVNGTYPAVDPENTNKIFESIQEVMNNVYFNH
FT                   NIPVIVVSPKIRAPFRKLVEIVYPNLTVLSLNEIPNDIKIKAEGVVSIYDDEKVYS"
FT   CDS             325014..326027
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="CDR20291_0268"
FT                   /product="signal recognition particle complex, GTP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01924"
FT                   /db_xref="GOA:C9YI75"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI75"
FT                   /protein_id="CBE01924.1"
FT                   /translation="MTKKYTANTIQDAMNLAKMELGDNITLIDKKEVRKSGIQGIFSKK
FT                   DIELTIGWEKRENVEQKDLKREIEQLKLIINNMGFDNKNDNDIDKICKNLLSLELNEEI
FT                   VESIRIDLQEMKFNGIDTSKNLVEILKKKIKIENQAINGKIALVGPPGVGKTTTIAKLA
FT                   AKLVFEENKKVGVITIDTYRIGAVEQLKIYTDIMNIPFKGVISPDEMELALDEMKDCDV
FT                   VLIDTTGRGYKNSMQILEIKNLIDKAETDNIHLVVNCTTRESDTKAIIDSYRNVNFKSL
FT                   IITKLDETITYGSIFNIMNYAQKPISYITTGQNVPDDIIKPNEDKIIRLLLGVESI"
FT   CDS             326024..326902
FT                   /transl_table=11
FT                   /gene="fleN"
FT                   /locus_tag="CDR20291_0269"
FT                   /product="flagellar number regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01926"
FT                   /db_xref="GOA:C9YI76"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI76"
FT                   /protein_id="CBE01926.1"
FT                   /translation="MIDQAQILRKMAMEKRGLDEFIVENENVPKIITIASGKGGVGKSN
FT                   LATNLSICLTKLNKKVLILDADIGMSNIDIIMGVNVKGTIIDVINGEKNIEDIISQTKY
FT                   GVNIISGGSALNHIEDFTEAQRNKFIHSIEQIHDVDFIIIDTGAGMSKSLLSFIYCSTE
FT                   FFLITTPEPTSLTDAYSLLKAISNFGIKRSANIIINRVIDLEEAKSTYKRIKMVVDKFL
FT                   NLNLELYGYIIDDKKVSLCVKKQIPFILEYPTSIASKCIIAIAKRMVSQSREDIVDNKS
FT                   FLRKMFSIFKS"
FT   CDS             326916..327617
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="CDR20291_0270"
FT                   /product="RNA polymerase sigma factor for flagellar operon"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01928"
FT                   /db_xref="GOA:C9YI77"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI77"
FT                   /protein_id="CBE01928.1"
FT                   /translation="MNREELIKENMPLVKSIARKFFIPGKGFEYQDLVNSGVIGLIDAI
FT                   NKFDAEKGAKFSSYSYIKIKSAILDEIRNQSPISKHNLTKVNKYNRVVEKLQSKLLREP
FT                   TSYEIAKELNVSEKELHDIESNIDMLNIVSLNYVIFEDTNETVQDVISDREEEAPENII
FT                   EEEEKLEILSKAISNLNEREKLILSLYYYEDLNLKEIGKVLGVSESRVSQLHRKSIRNL
FT                   RNKIKELKYSI"
FT   CDS             327633..328055
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0271"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01930"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI78"
FT                   /protein_id="CBE01930.1"
FT                   /translation="MIQIILIVVSILIIVTIVINLHKESKNKDNRYFDKIFEQEYEAND
FT                   RLIIAEKRRFFLDKVLAEIRSNNHIKVYENYNLIKANEERKENIFIESKKEVRQENELS
FT                   LKVKHLISSGYDDVEICKMLDIGKGELSLIRSCYKI"
FT   CDS             328266..329039
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="CDR20291_0272"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01931"
FT                   /db_xref="GOA:C9YI79"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI79"
FT                   /protein_id="CBE01931.1"
FT                   /translation="MIRGLYTAVSAMITNQQKQNVVVNNLANMDTNGYKSKQLLTKSFD
FT                   ELKLEGYNNYANGTKQKQIIGDISPGISMDETITNFNQGPIKTTDNKMDVAIQGKGFFL
FT                   VSDAAGNQFYTRNGNFRTDNQGDLITSEGYYVLGTNTATGAVGHINVGNQKFEVAKDNT
FT                   ISLDGNAMYKFNIVDFNDYNNLKKEGDNLYSGGGAMKVNNALTIQSAIESSNVDMVSEI
FT                   NNMMTISREYEANQKIIQAMDSKLAKIASEIGSVR"
FT   CDS             329060..329821
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0273"
FT                   /product="putative flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01933"
FT                   /db_xref="GOA:C9YI80"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI80"
FT                   /protein_id="CBE01933.1"
FT                   /translation="MYTMFYTSKTALSANQSKLDIISNNIANSDSTGYKKINMEYSDLV
FT                   DEVLNRPSYPTNGNDISTGTGAKATAPMRIYEQGALAPTDSKSNLAIDGEGFFRVIRKD
FT                   GTYAYTRNGGFNIDGLGKIVDDNGNILDVQFDAGYNYNNTNIDSTNLTVSRNGELFVDN
FT                   KKIGKINLYQPIGTQNFISEGDSLFVATDAAQIKQVEKVDIVQGYRERSNVSLQEEFVD
FT                   LIATQRAFQMNSKGIKTADEMWQIANNLRAK"
FT   CDS             329844..330725
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="CDR20291_0274"
FT                   /product="putative flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01935"
FT                   /db_xref="GOA:C9YI81"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI81"
FT                   /protein_id="CBE01935.1"
FT                   /translation="MNDMKEYDFGKPQSYSRENLTCLNFLLAEFCKKYKNYIIYELKCN
FT                   SSMIVDSIDQVNYQTFLDRVTSSCVVVQNAMEPVMKNFSFRIDRSVADMWIDITSGGTG
FT                   VIKDNDRELTELDKKVLLHLMDDLVRNMHLFEGFENIQVLDTHTHINLPQLCSPTAPVC
FT                   VVDLKVLNDNEYIGSVSLCFPYNGLEALLESISVIEFFDNDVGDDSEEFTKKIYNSVSN
FT                   IELSVIAEIGKVSINVEDLLKLEVGDVIVTNKKINDYIDIFVENSKSYTATPGFISSKK
FT                   GVKINDAVGKEV"
FT   CDS             330728..331102
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CDR20291_0275"
FT                   /product="putative flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01937"
FT                   /db_xref="GOA:C9YI82"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI82"
FT                   /protein_id="CBE01937.1"
FT                   /translation="MDNSNLISDEEAKMLLNDKVESEVDGDDELALDVSEVNRNNIQRI
FT                   LDLKLELSVVIGRTKMTLRDILNLHKGSLIELNTLADQDVEILIDNKVLAYGKVVVVDL
FT                   NFGVKITSIVSEEDMVKSLV"
FT   CDS             331134..332537
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI83"
FT                   /protein_id="CBE01939.1"
FT                   /translation="MVLILNLNDIKKDILKLNKKDSCSLYNESINNINNNCISTGLKFL
FT                   KQARDLNPDDVDILNLTGLVNLLKCNFDDAVESFYKSSLCEKTALCEKYINMLTSEEFL
FT                   IFFEKYNQLIRLINKGMYKEAIQGFKLITDQYCDLIEPYELLALLYDKEEEYIKFDECL
FT                   EVLKIIDKENYLLNQENNTLDMYNSANIQTKSNVKVDDYKNEFLHKSSSNHKINDYNNV
FT                   TKEKSSSKNQKSSDSNKKKSIKKNKYLYIAIILGILLVGQSIYSSYKMNNLTDKISKNN
FT                   ETKNEESIDSNLTKKENNIEENEDMSKASNINKSNKNINKEADVKSKKNTVENEDDKDS
FT                   DLFTEDELMSKANTLKSEKKTKSSIQLYKKVADIGENKGNTSEATYQVAILSEKLKDYK
FT                   TAEEYYKMYVENYSEKDAYFDESYYNLGMMYYNNGDLKNSKLTLKKLVNKVPNSMYNNS
FT                   KVKEILKEE"
FT   CDS             332653..334590
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="CDR20291_0277"
FT                   /product="chaperone protein (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01940"
FT                   /db_xref="GOA:C9YI84"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI84"
FT                   /protein_id="CBE01940.1"
FT                   /translation="MEFEKGSISIHTENIFPIIKKWLYSDKDIFIRELISNGCDAVSKH
FT                   KRLVSLGEISENKSSDYKITVSVNKGEGTLKFIDNGIGMTEEEIKKYINQVAFSGAEDF
FT                   FNKYKDKMEESNDIIGHFGLGFYSAFMVSKKVQIDTLSYTEGATPVRWISEGGTEYEIS
FT                   ESDARNDRGTTITLFIDDDSKEFLDEFTVRGIINKYCSFLPVEIYLEDVERLEREAKEA
FT                   EEKAKKQKEDGKEEIVDAKVIEPLNDTNPLWLKSPKDCTDEEYKEFYRKVFNVFDEPLF
FT                   WIHLNVDYPFNLKGILYFPKLKNEFELTEGKVKLYNNQVFVADNIKEVIPEFLLLLKGV
FT                   IDCPDLPLNVSRSFLQNDRDVSKISKHIIKKVADKLKSLCKNEREEYNKFWDDIQIFIK
FT                   YGCLKDESFYEKVKECILFKTIDDEYITIQDYLEKCKDKHENKVFYVSDKEQQSQYIKL
FT                   FKEYDLSAVVLNSSIDTHFISFMEYKENGVKFNRIDADLSDVLKDKNENKDSEENKEEI
FT                   AKIEGLFKEAVGERVKNYSVEGLKNEDTPAMVLVSEQSIRMAEMQSRFAGMDLGMNFEE
FT                   EKTLVINENSPIIKKLVSLKDDEEKKDKITLICNQIADLALLSNKELKPDELDSFVQRS
FT                   NKLMSLLIEL"
FT   CDS             334978..336108
FT                   /transl_table=11
FT                   /gene="dhaT"
FT                   /locus_tag="CDR20291_0278"
FT                   /product="putative 1,3-propanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01942"
FT                   /db_xref="GOA:C9YI85"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI85"
FT                   /protein_id="CBE01942.1"
FT                   /translation="MNFNYNLPVNILFGRGRINDVGKEVSKYGKKVLIVTGKNSTKKTG
FT                   LLDKTIDLLKDSKIEYEVFDRVEQNPLITTIYSGVEIIKSTGCDCVLGLGGGSIMDAAK
FT                   SIAFSYKNPGDLNDYIFGIRQGEEALPIILVPTTSGTGSEGNCFAVLTNSETKDKKSIK
FT                   KNSMYAKASIIDPELMVTMPKHIIASVGFDALAHNMEAYLSNGRNPLADVQAIYGIELI
FT                   SENLIKVYNDVNDLEAWEKITLASTIGGMTIGTAGTALPHGMEHPVSGLRDVMHGKGLA
FT                   ALTPTIIESSWDIDIERFGNISKVLGGTCAEDCSDAIRNFLKKIDLDIKLSDLGIEKSD
FT                   IDWLTDNCMKISVANIKRHPKYFNKEQIKEMYHKSL"
FT   CDS             336335..337357
FT                   /transl_table=11
FT                   /gene="spl"
FT                   /locus_tag="CDR20291_0279"
FT                   /product="spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01943"
FT                   /db_xref="GOA:C9YI86"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023897"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI86"
FT                   /protein_id="CBE01943.1"
FT                   /translation="MFNPKRIIFEKGTLDTDVGKKIYNKFRDNKDVEIINISSNRIKEH
FT                   IPGENLYEQYRSGKQTMVVGIRKSLKFQTCKPSANYQLPLVSGCMGRCEYCYLNTQLGD
FT                   KPFIRVFVNVDEILEQTKKYIEDRKPQVTIFEGAATSDPVPVEPYTNSLKKTIEFFGRE
FT                   EKGRFRFVTKYSDVDSLLDAEHNNHTEIRFSINTPRIINEHEHYTASANKRIESAVKLA
FT                   RAGYQIGFIIAPVFLYEGWKEEYKNLIISIKEALPKDFDKKIIFEVISHRYTTKAKNRI
FT                   LEIYPDTLLPMENEDRKFKYGQFGYGKYVYDKEQLDDMKEFFLKEINGVFKNSLIKYII
FT                   "
FT   CDS             337539..338450
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0280"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01945"
FT                   /db_xref="GOA:C9YI87"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI87"
FT                   /protein_id="CBE01945.1"
FT                   /translation="MHAWESIQITLDLIEANLSEEISINELANKANLSPFYYQRLFKRL
FT                   VNKTVMEYIKLRRLARASEYLAEHKNRILDVALNFGFASHETFTRSFKKAYGLTPEKYR
FT                   ANPVKLNHFIKPELILNYAMVDEGVPLIADDIVIEVNRKTLSNPRTFVGIEIEVPICQL
FT                   VGGETTGIAIVEELWMKLGSQRHNIPNQIPGGNEFAALYMGNAKEGNCMYMAGVEVESG
FT                   TSVEGYNTFELPAKEYLVCGFEAENFNELVNSAVFKADKFMERWMKKHNLTTTDFAIEM
FT                   YYPTTPEAAYLEHWIVPVPIEQ"
FT   CDS             338465..338881
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01947"
FT                   /db_xref="InterPro:IPR024265"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI88"
FT                   /protein_id="CBE01947.1"
FT                   /translation="MNWQDAFFQDTKPTFEQINEFINNPLWDKLNKTLVSTYNVEPKLE
FT                   YSKCSMQRGWNVKYKKRGKSLCTLYPQEGYFKALVIVSESNRVEVDLFINTCCDYIKKI
FT                   YNEVNFFNGSKWLMIQVDSLLVLNDMLELIKFRA"
FT   CDS             complement(338975..339367)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0282"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01949"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI89"
FT                   /protein_id="CBE01949.1"
FT                   /translation="MSINTEKNITKNVEELTCPIRYALDIVGGKWKLPIICMLAVENPI
FT                   RYSSIKRKLDGITNTMLAQSLKDLESTGIVHRKQYNEIPPKVEYTLTSKGKSIVPILQQ
FT                   FANWGATNMQEKNTCGLSCKECRKIK"
FT   CDS             339508..339903
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01950"
FT                   /db_xref="GOA:C9YI90"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI90"
FT                   /protein_id="CBE01950.1"
FT                   /translation="MKALEFLNKAGVYYLATVDENNQAHVRPLGFVMEYNGKLTFCTSN
FT                   QKDMFKQLIFNPKVELCCIDQNLNTLRILGEAVFVTSKETQAKALEIMPSLGQMYSVGD
FT                   GKFEIFSIDKAKVSCCSMSGKKIDVEL"
FT   CDS             340306..340512
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01952"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI91"
FT                   /protein_id="CBE01952.1"
FT                   /translation="MSKYSSLWEYVKKNNSQSFKLTFEEIKDIAGIEIDHSFLKYKKEL
FT                   NEYGYQVGKISLKEKTVIFNKID"
FT   CDS             complement(340823..341656)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0285"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01954"
FT                   /db_xref="GOA:C9YI92"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI92"
FT                   /protein_id="CBE01954.1"
FT                   /translation="MSNYVTIDFLSYSFYNINYVTLIFYRGGIYMNFLSDLHTHSIVSG
FT                   HGYSTLLENINYCKENGIKILGTSEHGPKMPGSPHRWYFHNIQNIPRIINNIIILRGCE
FT                   ANILDIKGNIDLEPFVIPRLDYLILSFHEAVFSPNTLENNTKALINAINKHDNIEILGH
FT                   LGNPNYPIDYELIIKLAIEKNILIEINNCSIKGVSRNGSSDNCKYIATLCKKYGAKIIL
FT                   TSDAHICFDIGNYEYSENILKEINFPDELIMNYPKKLINHFHQKGKLLDVDYTNI"
FT   CDS             341732..344299
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0286"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01956"
FT                   /db_xref="GOA:C9YI93"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI93"
FT                   /protein_id="CBE01956.1"
FT                   /translation="MTQKKLSRKEKVLICLKRLTEEHLNFNNGIRFGFDAEYIATEVGI
FT                   NRSNASKELNQLIKESIIIKIKGKPVQYLYKESIESILGKKLNKGIFDNINSINEYSEN
FT                   DSIKDEYILESIKKENNIFNLVGCDGSLRSQIEQAKAAVIYPPKGLSTLIIGPTGVGKS
FT                   IFAEYMYKYSLTIKEDSDNAPFIIFNCADYSDNQQLLLAQLFGYVKGAFTGADKDKYGI
FT                   VHEANNGVLFLDEVHRLSAEGQEMLFLLMDKGIYRRLGEANKVHECRVMIIAATTEDPE
FT                   TAMLETFLRRIPVTIKIPSLEERGFQERMKLICYFFKEESVRIGVKLKVSKEVIKAFIL
FT                   YKCKGNIGQLKSDIQLICARAFLDYMTYKRECVYVRLSLLPNNIRESLYGNNRKEEFVQ
FT                   NFSFIGKDDIIFLPEEKDFESENLLIENKKYDLDFYGMIKETWNKLQQEGIKESQIRSV
FT                   IDGDIQKYSYNLMNTFIYNNSNQTAYNNIVNDSIATTVKYILQKHDKWSKREGLDKLIK
FT                   AIALHIQNLIERIKIGNIVKHPNKDEIMKERAYEYNIAKEILSNMSLMYGVEFPEDEAI
FT                   FLATFLYLSYVGLNEESIAILVIMHGESTASSMVNVANTLLDCNHAVAINMGLEDRVQD
FT                   ILVQAVEIANKIDKGKGILILTDMGSILTFAKVIRDATGKEVKAVDMVSTPIVIEATRK
FT                   ALTPEMTLEKLYFNIIESIKKHYGDMEVTYAEKDNGGRYFDRLLIDNISKTLTFLNGEK
FT                   AYFILKEVINRISEHYSLVIQDELLVKFIFHCSCMIERVIIKESLVYKSYEERISRNKE
FT                   LYLVIKESFKLVEETFDIIISDMEYANILDIFESQYDTDKFKS"
FT   CDS             344520..344933
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0287"
FT                   /product="PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01957"
FT                   /db_xref="GOA:C9YI94"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI94"
FT                   /protein_id="CBE01957.1"
FT                   /translation="MKLVIGIIVMTHGSFSEEIIKSCELIAGPAERTAAIKLNRNDNIE
FT                   DLNKNFVEKLNELDEGDGVLVLADLLGGSPSNVASLNLKKGGKFHALTGVNLPMLLEAL
FT                   INREGKSLEELAEACIEAGQTGINNINKVLSSM"
FT   CDS             344957..345454
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0288"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01959"
FT                   /db_xref="GOA:C9YI95"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI95"
FT                   /protein_id="CBE01959.1"
FT                   /translation="MSLVKYCRCDDRLIHGQVIYKWVKHLGVKKIVVVDDETTNDVIAK
FT                   GLIKMAAPKNIDLSILTVSESRRYFYNNQADDNVFVLIKNLDTANRMIEEGINIKKLIV
FT                   GRIPTGIGKKKISQNVYINKKEFLLIDEFIKKNINVSIQMVPDEEEVELNQNINRYKGE
FT                   FI"
FT   CDS             345457..345858
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0289"
FT                   /product="putative PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01961"
FT                   /db_xref="GOA:C9YI96"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI96"
FT                   /protein_id="CBE01961.1"
FT                   /translation="MNKYKVIILCHGTWGKVLVEETNKNFGLSNQYEVLSLSSEKDVSV
FT                   FMKEVEEVVDKEDVKIIISDLYGGSTSSVAIAVAIRRGIDAINGLSLQTILIVDEELSK
FT                   EDKLHTLPERIVKKNNNLCVDLIKEFKKI"
FT   CDS             345876..346364
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0290"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01963"
FT                   /db_xref="GOA:C9YI97"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI97"
FT                   /protein_id="CBE01963.1"
FT                   /translation="MAKITLVRVDHRLIHGQVITKWVKIAQAQKIIIVDDFLGQDEFMA
FT                   DIYKMAAPSGVEVVILTAEDAGQAFQNNTLGDKNIFILFKNVDMANKAYKAGLKYEKIQ
FT                   LGGIPNEAGKKMVFTAVSLGNEDVEQLNELNENGVEIVLQVIPEESSMTYENALKKFK"
FT   CDS             346391..347146
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0291"
FT                   /product="PTS system, IIc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01965"
FT                   /db_xref="GOA:C9YI98"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI98"
FT                   /protein_id="CBE01965.1"
FT                   /translation="MESVLMLAIVTGLWYWFAAGLAGYTLFSTLKSPLFIGFSLGLLWG
FT                   DVTTGMIVGASIEMVYLGMVAAGGNIPSDKCLAALIAIPVALQTGVNAEVAVSIAVPLG
FT                   VIGVLVNNLRRTGNAVLVHKADKYAEEGNTKGIWRCATLYSLIFGFVLRFPIVFVCNFF
FT                   GADLVQSLLDVIPQWLMNGLTVMGGILPALGFATTIFTIGKNKFLPMFIIGFFMVQYFE
FT                   ISITAAAIFGVCIALLITFMKEDKRVGEV"
FT   CDS             347146..348009
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0292"
FT                   /product="PTS system, IId component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01967"
FT                   /db_xref="GOA:C9YI99"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C9YI99"
FT                   /protein_id="CBE01967.1"
FT                   /translation="MQEIKNKEVKNGQGPTEVNKTRVLTKKDVTKTYLRWWWTAELSNS
FT                   FERMQALAVCASFTPALEKLYKKKEDLVDALKRHLQFFNTQAIWGGLIHGTVLAMEEEK
FT                   ATEGKIPGEVISGVKNGLMGPLAGIGDTLDFGTFQTIFLALGASFGAEGSVIGAFFPIM
FT                   FSILLFCEGYYLFHLGYSLGRDSIKKILSGGIVNKIIDGASILGMFMMGALSATTVKLS
FT                   TPLSFDIGGKAIVVQDTLNMIAPGLLPLGVVFFVYWGMKYKKWTITKLLVILVVLALVG
FT                   SFIGIF"
FT   CDS             348056..348535
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01968"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA0"
FT                   /protein_id="CBE01968.1"
FT                   /translation="MSEKMYTEKEYLEGIRGATGERAVWFYLLMKEAEKLGANPDDICK
FT                   EAIYGFGKMRGQKYNVADTPGKMAEMLYNSKGQKVFEMELVENTDENGVLKFHHCPLDA
FT                   AWKEYGLTKEERKEICRLACYGDYGRVDCAQGVKLDFAQKCAHDDEVCELVFTKK"
FT   CDS             348600..349907
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0294"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01970"
FT                   /db_xref="GOA:C9YIA1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA1"
FT                   /protein_id="CBE01970.1"
FT                   /translation="MDISRSVDNSLNRTIEFLKELIKIDSQQGEPISQCPFGIGPKKSL
FT                   DKTLDYCASLGFSVKNIDNYIGYAEIGEGEELIGIPMHLDIVPPGEGWSVDPFSGAVID
FT                   NIIYGRGVIDNKGAVSMLIHVLKNIEDMYPTINKRIRLIFGTNEETDMKCIKYYLDKGE
FT                   EIPSMGFTPDAMYPVVNGEKGRVHIRIEKEIKIDKSKPYIIVRGGTKENVVPSHCTAKI
FT                   INGIISELTTKGVAVHASNPEKGENAISKMVIKIVEDNMDFQHREDIELVSKYLCSDYY
FT                   GDALGINQYDEVFKNTTLNLGILKVNEEKIVCELDIRYGKNIVLNNIIDRFKKVFCNGW
FT                   KIEVIAHKDLHYVDESNLVLKKLLEAYEEVTDENGYTIAMGGGTYASWFKDMVAFGPKF
FT                   LAYKTGGHGVDERVPINHIRKNMEIYTLALIKLLEL"
FT   CDS             350870..351964
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0295"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01972"
FT                   /db_xref="GOA:C9YIA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA2"
FT                   /protein_id="CBE01972.1"
FT                   /translation="MNELNIAKTLILKRKEKGITQDELANYIGVSKASVSKWETGQSYP
FT                   DITFLPQLATYFNITVDELICYEPQMMKEDINKLYNKLCKDFTVKPFDEVMDEIREIIK
FT                   KYYSCFPLIFRMGLLIVNHYDIVDEKKRELLISEALEIFIRIQETCNDIDICRQAKSME
FT                   ATCYILLNQPIQVIDLLQNSNFPMINESILLAQGQMMNGQMDEARETFQLGAYQNLISL
FT                   VQNLVGILQNADKLQMKEIERRILAISDIFELDTLSPAIMLSSYLTQTQINLIHGDNEG
FT                   AIKSLRKYVDLATRDIYPIIIHGDDFFNKLDRWISEIGTGITRDDTIVKAGIVAAIKNN
FT                   PMFSLLSENKEYKFLIEKLSLLEE"
FT   CDS             352166..353086
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0296"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01974"
FT                   /db_xref="GOA:C9YIA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA3"
FT                   /protein_id="CBE01974.1"
FT                   /translation="MMNIVSINGLSKGFGNRKIIDNLNFTVPEGSVFGFVGKNGAGKTT
FT                   TMKMVLGLLEPDSGTIDVCGEKVTYGRTSSNRHVGYLPDVPEFYNYMRPLEYLSLCGEI
FT                   TGLSKKEIKIRSEELLSLVGLGNEKRRIGGFSRGMKQRLGIAQALLSRPKLLICDEPTS
FT                   ALDPVGRKEILDIMLKIKDSTTVIFSTHILSDVERICDHVAILNKGSIALSGTLSEIKS
FT                   MHGKDRLLLEFASNNEIQKFKSSGGIKSLLKDSEETNMEIVLHGKDIKAIQKTVISTLA
FT                   EMNLCPVKMELIELSLENLFLEVVK"
FT   CDS             353083..353841
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0297"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01975"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA4"
FT                   /protein_id="CBE01975.1"
FT                   /translation="MREYIAFTKKEFKENIRNYKLLSLTILFLVFGIMSPLSAKFMPDL
FT                   IAHFAPTLKVTTAPTALDSWTQFSGNISGLGTSLTLIVFCNILSNEYSKGTLVIMLTKG
FT                   LSRSSVVLSKFSIAVIIMTIGFWLSFLCTYGYTMYFWPTANLNHIIFSAFNLWLISIMY
FT                   ISILILGCVLFRPAFASVLLVLAATAILSLISIPKQIAPYTPNFILSKNIDLVSGKVTP
FT                   PEFIIPIIVTIVISIVCLLLAVVLFNKKAV"
FT   CDS             354224..355297
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0298"
FT                   /product="putative iron-sulfur-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01977"
FT                   /db_xref="GOA:C9YIA5"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA5"
FT                   /protein_id="CBE01977.1"
FT                   /translation="MEKSKVYFCDLYSNSQNKNVPNNVRRLFDEAGFKDLIEKNDQVAI
FT                   KLHFGEKGNTTYMSPVAVRQVVDKVKDCEGKPFLTDTNTLYTGSRTNSVDHLTTAIENG
FT                   FAYAVVNAPVIIADGLYSRNYENVKIDKKHFESVKIGGEIYNSSAMIVMSHFKGHEAAG
FT                   FGGALKNLAMGCASAAGKQMQHSDVTPVVKEKKCVGCGKCVNSCPTKAISIVDKKAVID
FT                   SDVCYGCGECPTVCPTRAVTIQWESDSDVFVEKMAEYAYGAVSNKKDKVGYITFVMNVT
FT                   PLCDCVPWSGRPIAHDIGILASTDPVAIEQACYDLICKEMGHDVFKHEHPHVNGTRIID
FT                   YACEMGMGSKEYELIKL"
FT   CDS             355367..355630
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01979"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA6"
FT                   /protein_id="CBE01979.1"
FT                   /translation="MKIYYEKENSKKANVNNIPSVFAFNFLRNFLTSKEYEETRKEYFI
FT                   NNLTKSQVNQAMKDLKWLFREYEGLEVITMESLDGVKTRIVL"
FT   CDS             355836..356813
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0300"
FT                   /product="putative biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01981"
FT                   /db_xref="GOA:C9YIA7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA7"
FT                   /protein_id="CBE01981.1"
FT                   /translation="MEKYIIKLKNKVLREKEISYEEALNLISLDTNNKNDFDILLKSAN
FT                   EIREYFMGRKADLCTIMNAKSGKCSEDCKFCAQSSHYKTGVEEYSLLDYNEILNRAKEM
FT                   ESKGVHRFSLVTSGKGMSGKEFNNILNIYEGLRENTNLKLCASLGIIDYEQAKMLKSAG
FT                   VTTYHHNVETCRDNFHNICTTHTYKDRIKTIKDAKKAGLDVCVGGIIGMNESEEQRLKM
FT                   VFEIRELNVKSFPINILNPIKNTPMENYDVLEPMEILKTTAVFRFIIPNVYIRYAGGRL
FT                   SLKGYDKVGFNGGVNSAIVGDYLTTVGSGIENDKKMIIEQGFEL"
FT   CDS             357032..358054
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="CDR20291_0301"
FT                   /product="putative ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01983"
FT                   /db_xref="GOA:C9YIA8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA8"
FT                   /protein_id="CBE01983.1"
FT                   /translation="MNFLSITIKEIGELAGVSKTTVSKVINNKDENISQATREKILKIM
FT                   KEKNYVPNKLAQSLVTKKTNTIGLLIPDIRNPFFTDVSRGVEDKANEEGYNIILCNTDE
FT                   DAKKEYEGIRTLSERMIDGIIFAASSNTNWKEANYKDIKIPTVLIDKKISMNKETLKGI
FT                   VKINNFEGAYIATKHLLDIGNKKIIYLSGPLQNEIAVDRLEGYKKALIECNLSYNSAYV
FT                   FEGKYKIEWGQEFIKNLEKIDFDAIFCANDLIAIGVIRGLKERGLSIPNDVSVVGFDDI
FT                   QTSSLISPSLTTVKQPSYDIGYKASEILINCLRGDKKESFDELIFKPELVIRDSTKESE
FT                   "
FT   CDS             358096..358986
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="CDR20291_0302"
FT                   /product="putative ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01984"
FT                   /db_xref="GOA:C9YIA9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIA9"
FT                   /protein_id="CBE01984.1"
FT                   /translation="MGNIVVIGSVNMDMVCSVDKRPEKGETVLGNSFFTSPGGKGANQA
FT                   ISASKLGANVKMISCIGEDGLGEELIRNFRTNKVDYSLVSRNNHKSSGVAVITLCENDN
FT                   SIVVVPGTNELVDIELIKKNEEEIKNADIVLLQLEIPLKTINYVVNFCFENRIKVLLNP
FT                   APAVKLNEDIIEKVTYLTPNEHEYKIVFDTNEGIEEVLKKYPNKLVITEGKNGARFYDG
FT                   EEIKHVSCISVDVQDTTGAGDTFNGALAVAITEGKKLYTAVEYAVVVSGLSVTKLGAQS
FT                   GMPYKEDVEKYLNNK"
FT   CDS             359034..359996
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="CDR20291_0303"
FT                   /product="D-ribose ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01986"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB0"
FT                   /protein_id="CBE01986.1"
FT                   /translation="MRVRKILSLGIAGILAIGMLTGCSMEGPSKSDNKGGSDKKDLTIG
FT                   VSTITLQHQFFIDIDEGIKEKAKELGVKVIVNDPDQDVAKQTSAIEDFIQQNVDGMIVL
FT                   GTDNSAIVPAVEGAFEKMPVVTVDAVLNTENITSYVGTVSYDAGKKLGEYTKKYIDEKL
FT                   GGKSEIAIVTDLKSQIQMQRIDGFKDALKGSANVKILNSQPGYDREESLNTVENLIQSN
FT                   PDVDIIYATAENSVLGAKAALESAKNKDVKIVGFDLTEEASSGITDGTILAMIQQQPKE
FT                   MGRLAVEAVVKAIKGEKVEKNIPVPALLYDKENIKDFKN"
FT   CDS             360050..361561
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="CDR20291_0304"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01988"
FT                   /db_xref="GOA:C9YIB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB1"
FT                   /protein_id="CBE01988.1"
FT                   /translation="MSNIILKLSNIAKEFPGVRALDNVNFELFHGEVHALLGENGAGKS
FT                   TMIKILTGAHSKTSGKFIFEGKEIENISPDISKKIGINAIYQELTVFDELTVAQNIFMG
FT                   KEINGKVLTNDKKMNEEAKKIFDNMGIDINPNSLVKELSIAQKQMVEIARVLSSETKVL
FT                   IMDEPTSSISKKETEILFRLINDLKESGVSIIYISHRMEELFEICDRITIMRDGKTIST
FT                   LNTKDVSSEEELVNLMIDRKLDQFFPKRKVEIKEEIMRVENLTKNNVFNDISFNIRKGE
FT                   ILGIGGLVGSKRSEIVEAIFGLRTYDSGKIYLNNEEVKFKTPSDAIENGLGLITEDRKG
FT                   TGLFLQMSVKENTTMAGLKKISKFKSIIDRKKEKEILEKYIEALKIKTPHMNQVIQSLS
FT                   GGNQQKAIIARWLLLQPDILIMDEPTRGIDVNAKAEIYNLMGDLVESGVSIIMISSEIP
FT                   ELISMSDRIMVMREGHISGFLEGEEMVENNVLKLAFGGKINEFNN"
FT   CDS             361545..362543
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="CDR20291_0305"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01990"
FT                   /db_xref="GOA:C9YIB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB2"
FT                   /protein_id="CBE01990.1"
FT                   /translation="MSSITKHKEEKSSPLLTKLTSVFRDQGSAAVGLVIIFIIMSVASS
FT                   NFLTLDNLINVGRQISINAILAVGMTFVIITGGIDLSVGAVIALVGTFWATTVVNYNAP
FT                   IWVGMILALAIGTILGVIKGAIISTQKLPPFIVTLAMLTIISGASFVFTGGRPISVNTD
FT                   AFKMLGRGYIGPIPIPVIIMIIVVIAGHFLLKRTNFGRHVHAVGGNEEAARLCGVKVNK
FT                   VIVKVYALAGLLTALAGIILSSRLASGSPTVGDGAELDAIAAVVLGGTNMMGGSGSIVG
FT                   TCIGVGIIGILGNGLNLLSVSSYNQMIIKGLVMLFAIWINNIKLKKSAKSK"
FT   CDS             362727..363989
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="CDR20291_0306"
FT                   /product="putative acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01991"
FT                   /db_xref="GOA:C9YIB3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB3"
FT                   /protein_id="CBE01991.1"
FT                   /translation="MKKILLDTLNSKKQEYIDYLKELVSIKTEDVGHGILGGFEKEGQE
FT                   YIEKLANYIGFSVDRQEMSEELIKKAKNIYKEGNLGHNYQDRYNLICKYSDDLPGKTIV
FT                   FNGHVDTMPPGDISKWKYNPYRATEDNGKLYGLGTADMKSGLIASILAVKLIKDSGLNV
FT                   PGNVKIMSVVDEEGGGNGTINAVMNGIGGDCCIICEPSEQNLIVAHMGFVFFEVEVKGV
FT                   SLHCGSKWEGVNAIEKAMLLLQDIKELEHNWLMIYKHPLLPSPTINLGVINGGTAGSTV
FT                   PDKCVFNLCVHFLPNIMSYEQVVNDVTNVIMTRANGDLWLKDNKPNINIYQSGLGFQMD
FT                   KDSDFVVNAHKILEETLGKKLEIKGSTAGNDARLMKNLAEIPTLILGPGSIEQCHSIDE
FT                   YVEIKEYLDSILMYASLILNL"
FT   CDS             364009..364752
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01993"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR017027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB4"
FT                   /protein_id="CBE01993.1"
FT                   /translation="MKKVLIVGESWVKNITHIKGFDTFVTTHYEEAVKWLKEAIESGGY
FT                   ETVHMPAHVAADSFPYKLEELNEYDCIILSDIGSNTFLLSNSTFIDCNSNPDRLELIKE
FT                   YVNNGGALIMVGGYMSFTGIDAKARFGETAIKDVLPITMIDKDDRVEKPAGIIPEVIDS
FT                   EHPVLKGIPTEWPKFLGYNKTVARDNCPVLATIGGDPFVAVGEFGKGKSAIFSSDCAPH
FT                   WGPKEFTDWKYYNKLWVNMLDWLTC"
FT   CDS             364925..366310
FT                   /transl_table=11
FT                   /gene="abgB1"
FT                   /locus_tag="CDR20291_0308"
FT                   /product="putative aminobenzoyl-glutamate utilization
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01995"
FT                   /db_xref="GOA:C9YIB5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB5"
FT                   /protein_id="CBE01995.1"
FT                   /translation="MDNLNKKFLMEYIDEIQGELRDISDKIWKNPELQYKEYYASNLQK
FT                   ECLKKHGFSIEGLEGMDTAFVASYGEGRPVIAVLGEYDALDGLSQKVSTTKEPIVDGGA
FT                   GHGCGHNLLGTGSIGAVIAVKELIKLKKLKGTIKYYGCPAEEDLSGKVLMIKKGFFDGI
FT                   DCAFSWHPFDINTPIRIPTLANYSVKFRYNGISAHAAQAPYNGRSALDAVELMNIGCNY
FT                   LREHIFDNCRVHYVTTNGGKMPNIVPDFAEVWYYIRGVKMEHVRDVFGRIVDIAKGAAL
FT                   MTGTIMEYDIISGVYDYIPNTILTDILSQNMKLVGVQNYNEDDYYFADKLAETVSIDKR
FT                   SSVSSVLSGNKDITKMNLHDEVTDDTFTHNNCISLSLDIGDVSYIIPTAQCSCSVWPIG
FT                   ISAHTWQSCASAGSDMGFKAMLLASKSISCSINDVMLDELVINKAKKELKDTVGSFEYT
FT                   PII"
FT   CDS             complement(366647..367291)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0309"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01997"
FT                   /db_xref="GOA:C9YIB6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB6"
FT                   /protein_id="CBE01997.1"
FT                   /translation="MNNLDKNNVNEVLDMLLRTRRSIRSFTKEVPSKGLIEEIIETGRL
FT                   APYAILSVAKQTDFRHFFVISNNSLQMNKIKTILVDVIKTQISVNEKKAKNNITLQSFI
FT                   TSLKMQVEKGVLGIGTAPYLIIVAERRGIPPIEQKSLSHVMQNMWLKSTALGLGFELVS
FT                   VIGRLSDNKDFCDILGVPTGEYGFDACAIGFPTTSVTREGRAIPHPSIKWI"
FT   CDS             367555..368169
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0310"
FT                   /product="tetr (putative transcriptional regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBE01998"
FT                   /db_xref="GOA:C9YIB7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB7"
FT                   /protein_id="CBE01998.1"
FT                   /translation="MKKVSIDRRTIRTKKMIRSALAELIDEKGFNNISVTDLTQRADIN
FT                   RGTFYLHYVDKYDLLERIENEIIQEIEEETKHLDSSNMMEIDTSSEPLPFMVKLFEYFR
FT                   KNSVIIKSILGPKGDPTFERKIKKFIETNLFEKQKLINFNIDEAIISEEYFIQYILSAD
FT                   LGVIQYWLEKNMKESPEEMALILARMSLLGPLRAVGIRKDS"
FT   CDS             369905..370816
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02000"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB8"
FT                   /protein_id="CBE02000.1"
FT                   /translation="MHYKINELENKYNLYNKVVQKGVFMFGYVKINKMDLTFREYDYYK
FT                   AYYCGLCKYLKRNHGEISRFSLNYDITFLIVLLTAVYNPESISTEEVCIVNPFKKKKVI
FT                   TNDITEYAASMNILLTYYKLEDNLMDDKRIKDKLAYYIYKNKLKLAYEKYPEKAEYIKQ
FT                   QLNELNKLEKDKNINIDEVSSIFGNIMGEVFVYKKDENERNLRMIGFNIGKYIYLLDAY
FT                   EDLDEDFKKGRYNPFIEYIDKNDELKEKVKKIIVTSLGFLARGIDNLNLNKNVGIIENI
FT                   IYSGVYLRYINILESRGGKNVQ"
FT   CDS             370806..371249
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0312"
FT                   /product="putative 'four-disulfide core' protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02002"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIB9"
FT                   /protein_id="CBE02002.1"
FT                   /translation="MYSNTYNNENFMRARAFIENSEFKKAYDFLKTLTDKCAEWYYLTG
FT                   FSAMNIGYYEEGEDFLKRAKFMEPENSEYSDALRSYTQYRNDYSNRADNYNRRRRNDLD
FT                   GCCCCCCDDCCCCLGDDCCENCAKLWCLDSCCECFGGDLITCC"
FT   CDS             371251..371751
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0313"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02003"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC0"
FT                   /protein_id="CBE02003.1"
FT                   /translation="MINMSIKVAYGGVLLALNVILLTLTNIIPVNTLFIMGLASLLVSI
FT                   VIMEWGFKSGIAFYIGSIVLGFIVMASKSQWIVYSLTFGIYGIVKYLIEKDRSIYIEYF
FT                   MKLVFANIMILILYFLLRTIVYIPINIFIIGSFEIAFIVYDYVYSSFIGYYNNRLRKML
FT                   FKK"
FT   CDS             complement(371953..372681)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0314"
FT                   /product="putative phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02005"
FT                   /db_xref="GOA:C9YIC1"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC1"
FT                   /protein_id="CBE02005.1"
FT                   /translation="MKNIAAFFDIDGTLYRDSLMVEHFKKLIKYDIIDQKNWYKHARDT
FT                   FMDWDKRQGNYDDYLLEICDLYVDSLKGLDKTCINFTSDQVIKLKADRVYKYTRSRIEW
FT                   HLNQGHIVIFISGSPGFLVEKMAKKYNVTDFLGSDYVFENNIFTGTVIPMWDSISKNNA
FT                   INDFVVKYDLDLSNSYAYGDTNGDINMLKRVGNPIAINPTKELLSQISLDEEISKNVEI
FT                   IVERKDIIYSLSTDVNIVDI"
FT   CDS             372806..373894
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02007"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC2"
FT                   /protein_id="CBE02007.1"
FT                   /translation="MNFNFAKATNSRLMGSLGLIINWIDDENNHFCQYFLLDAEGLGLA
FT                   DYVSLNNPTQEEAYMEEERLMGGFGSDRVELTKDESLFLVSYFGNKNLYYDKLLPGDKC
FT                   EYIDIIKNYKTDLIIEKLYNKICKRVDEEVEFINYMTMRFIAWDRESLKYFSGSDEIAN
FT                   MHITNINGTLLKNVVSDKGQGRYISEALYEDNDGYYICKIAFCISKCYETGFRINSLLV
FT                   TDKELMYDFEVFDEISKSEFVSVYSVNSPEEFAGVFYRENPFLLKSNMNEGIFFTRFNF
FT                   NNDHVKENVYIINNDMKAIYYLMGNKFFIGTYNENDCNYINEISQSNYSDYIKFEEKFF
FT                   FEQNALYDFAESGSLDFDDFLE"
FT   CDS             complement(374332..375180)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0316"
FT                   /product="putative spore coat assembly asparagine-rich
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02008"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC3"
FT                   /protein_id="CBE02008.1"
FT                   /translation="MSNKKKKDLDTSYMPYLDPANYADYITNEEIPQDELRNDPQISNG
FT                   YTKIPNNQNINNLYPNNVNHYPKSSNSPNNLPNTNNTSGNMNYNTSATNNMPNNMNNNT
FT                   GMPNNMSNNMNSNMGMPNNMPNNMNSNMGMPNNMSNNMNSNMGMPNNMPNNMNSNMGMP
FT                   NNMPNNMNSNMGMPNNMPNNMNSNMGMPNNVPNNMNSNMGYNMNNTMGIPNFSCNQNMP
FT                   PNVLMMIPGVICHNTMQGMPVVMPSTMPPNIYPTPYGSSNMSIQGIPQATNIEEFDEEE
FT                   M"
FT   CDS             375379..375744
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0317"
FT                   /product="ArsR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02010"
FT                   /db_xref="GOA:C9YIC4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC4"
FT                   /protein_id="CBE02010.1"
FT                   /translation="MREEINDCNCNIVHEEIVTEAKSTMPDEEMLYDLAELFKVFGDTT
FT                   RVKILYALFANEMCVCDIASLLNMTHSAISHQLRVLKQARLVKFRREGKTVYYSLDDSH
FT                   ISQIFDCGLNHIRETYK"
FT   CDS             375767..378154
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0318"
FT                   /product="putative heavy-metal-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02012"
FT                   /db_xref="GOA:C9YIC5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC5"
FT                   /protein_id="CBE02012.1"
FT                   /translation="MEANNLIKKEFILGGLNCAHCAEEINNKVSKLQEVKSSNLNFINK
FT                   KLIVNIKESFNEDTTIEKIIDIIDSTEPGLDIQISSKENASSKTSIKKELILGGLNCAH
FT                   CAEEINNKVSKLKEVESSNLNFVNKKLTVNISNNFKEDDVINKIKEIINSTEPGLDIQV
FT                   GSTDKVKGRTTEKSGAVNDTNKKELVPLIIGALVYIFGIYQTATGYESQFSNIVFIVAY
FT                   VIVGGDVLLRAIRNISKGRVFDENFLMALATVGALTIGESSEAVGVMLFYKVGEYLQGV
FT                   AVGKSRKSITSLMQIRPDYANLKFNSEVKVVSPEEVNVGDIIVVKPGEKVPLDGVVVDG
FT                   VSMLDTSALTGESVLREVEKGDEILSGVINKNALLSIEVTKSFGESTVSKILDLVENSS
FT                   IKKSKTENFISKFSRYYTPIVVIAALLIAFVPPLVISGEVFSDWLYRGLIFLVVSCPCA
FT                   LVLSIPLSFFSGIGFASKNGILIKGSNYLEALRSVDTVVFDKTGTLTKGVFNVTKLNPE
FT                   GISEEELLEYAAIAEVNSNHPIAKSILSYYNKKIDLDTIDSYEEIAAYGIRVKHNGNFI
FT                   LAGNEKLMKKENISYSSAKEVGTVVYIAVDKVYRGYIVISDEVKEDSKNAIRSLKAIGV
FT                   KEVVMLTGDNEKVAKNIAQELELDTVYSNLLPNEKVDRLEDLYEGRTEKEKIAFVGDGI
FT                   NDAPVLARADVGIAMGGLGSDAAIEAADVVLMTDEPSKISKAIEIANKTNKIVWQNIIF
FT                   ALGVKIIVMILGAGGVATMWEAIFADVGVALIAVVNAMRAMR"
FT   rRNA            378649..380273
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   rRNA            380464..383416
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            383489..383605
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   CDS             383783..384391
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0319"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02014"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC6"
FT                   /protein_id="CBE02014.1"
FT                   /translation="MSVINSFILQYGLISVFVLIMIEYACFPLPSEVVLPLCGAIAARN
FT                   HFGFLTILILSIIAGILGSIFCYTVGNWGGKSIINKIIEICPKAKKGIFASQDYFNKYS
FT                   SISVCVCRLIPLCRTYISFIAGIAGQNIITFVISSIVGITIWNTSLISIGYIFSESWVR
FT                   IMSHYNDYKFLVLIIPISIIFIGFVIKSFIHKKHHKIRL"
FT   CDS             384413..384625
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02016"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC7"
FT                   /protein_id="CBE02016.1"
FT                   /translation="MYKVIKTVEKIEGVVNLHKHYVFVGSRRFFYCLCLWYFFLKMYHV
FT                   LHFVEDKFAYIEEKAAALKIKTTTL"
FT   CDS             complement(384932..385705)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0321"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02017"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC8"
FT                   /protein_id="CBE02017.1"
FT                   /translation="MWKLLWAECQKIRRSKIVWITFFASIMIAVIVFAGGQDVYNDPDL
FT                   HYGLKSVYDGSRYIDNAGWYMDAVQPWSTFFVLPAVIALLGSYIICREEEEDTIKSLRL
FT                   IPINETKLTIAKMIITFIFSILLYLLLFTITFLTESVLHFSDLSTKLVLSCMKEYFLDG
FT                   IGVFFAISPIIALVSRMKKGYWLALVFTEVYSIAGLFAGMSNVLQTFFPIAAIFNISGY
FT                   YITTGEKIMGSIISLLLCACLSAFILKGLKHNEKN"
FT   CDS             complement(385716..386453)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0322"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02020"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIC9"
FT                   /protein_id="CBE02020.1"
FT                   /translation="MLKLIQTEFLKLRRRKLIWLMLLSALIMPFFALLYFNYFGKTGVE
FT                   PTKFYKWSAFGYTLWIILPVVLGIFCTMLIHEENQYDMLKQLWIVPISKMGYFFSKFFV
FT                   VLIYSICFMLITAVASVLFSVLSGYVVFSWASILYLLKKCLEIGVITAFVMLPILAIAT
FT                   SQKGYILPICITLVYAFSGFVIMTINMYLHPLSSMGVIIMRNKDIPGLIFSQEINVPLA
FT                   FLCICIWSIVSVLFASIALGRRK"
FT   CDS             complement(386446..387435)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0323"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02021"
FT                   /db_xref="GOA:C9YID0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID0"
FT                   /protein_id="CBE02021.1"
FT                   /translation="MILTLYQLSFVETNLLKVRKLYMNDFVIETKQLTKIYGNQTVVDK
FT                   VNLHVKKGRIYGLLGRNGAGKTTIMKMILGLTSITYGEVDVFGENIKGCEKRVYPRIGA
FT                   IIETPGFYPNLTGTENLEIFAKLRGTAAPNSVKRALEIVGLPYKNKKLFSKYSLGMKQR
FT                   LGIANAILHDPELLVLDEPTNGLDPIGIAEMRKFIRDLSVEHGKTILISSHILSEISLL
FT                   ADDIGIIDHGVLLEESSMSELEKKNSKYILLQVSDIPKTSLILERQFNTKDYSVQDDHT
FT                   LRLYNTTLDMGEINKALVMQNVTVISSQLCNDTLEDYFKKITGGEGIA"
FT   CDS             complement(387526..388449)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0324"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02023"
FT                   /db_xref="GOA:C9YID1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID1"
FT                   /protein_id="CBE02023.1"
FT                   /translation="MNTSVYLLLILALSLIIIAYLVSVLLRVRIQLTLIKDALEDIKNG
FT                   NLNRRILTDENDITKQICYDINEIAINSQFQLIQQKQSEQAYKQLMTSLSHDVKTPLAS
FT                   LVGYLEAVESKIVVGEEKDEYIHVASNKAHYLKNFVENLFEWVKLDSKEQVFHFDIFDL
FT                   NELSRNIISDWIPVLESSHFEYEFDIPEIEYFLRIDANAYTRIINNLLQNIITHSSGNK
FT                   MTLRIFENKEQAQIIITDNGKGISSDNLPHIFERLYQCDHSRASKGNGLGLAIAKELIN
FT                   AHKGNITANSTPGMGTEFTILLPKAL"
FT   CDS             complement(388451..389185)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0325"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02025"
FT                   /db_xref="GOA:C9YID2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID2"
FT                   /protein_id="CBE02025.1"
FT                   /translation="MVERKEERKYNMNSVLIIDDDKELCALMKKCVEQENLSAITAHCG
FT                   AEGLHLLDKNRHTLSLVILDIMMPDIDGFQVLKKIRETSNIPVIMLTAKNDEDDKVSGL
FT                   RLGADDYLTKPFSINELMARVNSLIRRYTMLNPAFITDTDCIIINGMIIDKTNRIVSIN
FT                   NIPVQLTSKEFDLLAFLASNKGRVFTKKQIYTQVWEEEYAFDDSNIMSFISKLRKKIEP
FT                   DPNHPFYILTVRGVGYRFNKEA"
FT   CDS             complement(389145..389333)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID3"
FT                   /protein_id="CBE02027.1"
FT                   /translation="MEYMSCPEVAKKWGISERRVQKLCEESRIPGVSKLGYMWLIPKNA
FT                   EKPVDGRAKRRKEVQYE"
FT   CDS             389562..390491
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02029"
FT                   /db_xref="GOA:C9YID4"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID4"
FT                   /protein_id="CBE02029.1"
FT                   /translation="MDIIDNLRVQGVDEKLIEDVLYFRNYYGLEKDLEYRVTKSKTYFY
FT                   GKDILSMCIAAILEEENILLSGPKATGKNLLADNLGEIFNRPQWNTSFHINTDSSTLIG
FT                   TDTFIDNEVKLRRGSVYECAINGGFGVFDEINMAKNDAIVVVHSALDYRRIIDVPGYER
FT                   VNLHPATRFIGTMNYEYAGTKELNEALVSRFMVIDIPPIEEDKLMMILKNEFSDADEEK
FT                   LIHFAGIFLDLQLKSQNGEISSKAIDLRGLMASLKTIRRGLKPTLAINMGLTGKTFDVY
FT                   EKEMVGDVIKTRIPNKWESIDVFPISHI"
FT   CDS             390505..392277
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02030"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID5"
FT                   /protein_id="CBE02030.1"
FT                   /translation="MKWIYDDYEFENRANNLSWTIAGDYNESIDISEKDYSSKEIGLYF
FT                   AIIAGARRKYVDWDIVKKYLTNRIRKGYNKDIILGLIQVILNTIVEEKVIKDRPGIEDI
FT                   RRNAYKDIVSRFTKIHNDNIMDKIKYTFVLYNMDKHPALDSMTRRIVNDIRNIDTNQDM
FT                   MEILKALDVIYLTYFEYILNGEENSLIDENNVESVEVNFDTFADFMYEELYSDEEENII
FT                   ESDIDSISSSMLVEGVGDFDDSKCSNSADRVIYVDEDTANKIYSKIEHYYGKTYLSKGE
FT                   IKKIETQNCRNVHEGCRIHFTDGVLRSECNNVFQLKYVTRQKENNLGKFREHARMYRQQ
FT                   IKRLKESLSRILIEENAKSRVYSDCGTILANRAWRVGRSNNNKIFYKDIENEKGKYVID
FT                   ILLDASGSQSRNQGNVAIQAYIIANALTEVGIPNRVMGFSSFLDYTILKRFKDYDDSIK
FT                   NSENIFEYFCAGNNRDGLAIKSICSGLINRDEENKILIVLSDGRPNDVKIGKSSERTLR
FT                   GEKAYRGIVGLRDTANEVRKARKQNILVLGVFTGKESELEAERLIYGNDFIYSRDITRF
FT                   SDVVSMYLKKIIRN"
FT   CDS             392790..393542
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="CDR20291_0329"
FT                   /product="putative cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02032"
FT                   /db_xref="GOA:C9YID6"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/Swiss-Prot:C9YID6"
FT                   /protein_id="CBE02032.1"
FT                   /translation="MKQNIKLGVIAALMLIVLTPVTSNAMHIMEGYLPVKWSIAWGVIF
FT                   IPFFLVGLKSIGKIVKQDPKKKVLLALCGAFVFVLSALKIPSVTGSCSHPTGVGLGAIM
FT                   FGPSVMFVLGTIVLIFQALLLAHGGITTLGANAFSMAIIGPIISFLIFKALKKKDGNNA
FT                   MPVFLAAAIGDLATYTVTSIQLALAFPDPSGGVMASAIKFLGIFFMTQIPIAIAEGILT
FT                   VIVYNLITENGEKSILENNDKGVKANEC"
FT   CDS             393532..393816
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="CDR20291_0330"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02034"
FT                   /db_xref="GOA:C9YID7"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID7"
FT                   /protein_id="CBE02034.1"
FT                   /translation="MSAKTKTKTNILLLLLVVALIIFPLLVNSGAEYGGADGQAESEIT
FT                   KINPDYEPWFSSPYEPPSGEIESLLFSAQAALGAGVIGYILGVQKGKRS"
FT   CDS             393819..394517
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="CDR20291_0331"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02036"
FT                   /db_xref="GOA:C9YID8"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID8"
FT                   /protein_id="CBE02036.1"
FT                   /translation="MLIIDKYAYTNRLSKVNPNKKVAIGVIFLIASMVIKNIFVLSGIM
FT                   ILMSILVVCVAGIDLKNYLKLLRIPMYFLFLSIGITLVNISFNKADLLYSFEIFSFNVG
FT                   ISKASIDMSIHVLFRAMSCLTCVYFCILTTPFNQLIFFFKKMHLPDTFVELSMLIYRFI
FT                   FIFLEEFSEIYKSQELRFGYINLKTSYKSLGILGSMLYKRLMTRYDDMCISLDIKLYDG
FT                   KFHIVGDNDV"
FT   CDS             394510..395328
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="CDR20291_0332"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02037"
FT                   /db_xref="GOA:C9YID9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YID9"
FT                   /protein_id="CBE02037.1"
FT                   /translation="MFKINNLTYQYEKNTNALLNINMDFSKGNVIGIIGSNGSGKSTLF
FT                   MNLMGILKPTSGEILFKEEKLKYDKRSLYNLRKNVGIVFQDPEKQIFYSKVYDDIAFAM
FT                   RNIGIDEKIIKERINKALVAVNGIDFIDRPVHFLSYGQKKRVAIASVIAMENEIILLDE
FT                   PTAGLDPVSTRSIVDIIKGLNKDNIKIVISSHDMNLMYEICDYIYVLDKGILIDEGKAE
FT                   NVFVNENNIIQAGLESPWLVKVHRNMNLPLFKKEEDLYKYWKERELNTNK"
FT   CDS             395559..397847
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="CDR20291_0333"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02039"
FT                   /db_xref="GOA:C9YIE0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE0"
FT                   /protein_id="CBE02039.1"
FT                   /translation="MAVNRRRNMNLDTLNPAQREAVEKTEGPVLILAGAGSGKTKVLTT
FT                   RIAYLIEDKGVQAPNILAITFTNKAANEMRERVEQNIGPETKDMWISTFHSCCVRILRK
FT                   DINKIGYNRSFVIYDSADQVTLVKDCLKELNLSDKVFEPKAVISAISGAKDKLYTPKQF
FT                   KDINMADNRMVKIADIYALYQDRLKRNSALDFDDLILKTVELFKANDEVLAYYRSRFRY
FT                   IMVDEYQDTSKAQYELIKLLAREHQNICVVGDDDQSIYGWRGADIRNILEFEKDYDNVH
FT                   VVKLEQNYRSTQVILDAANKVISNNIERKRKKLWSEKKEGELIKIQLTGSEIEEADFIA
FT                   DSIAQIARKENRPYKDFAVLYRANAQARPVEDALNRSQIPYNIYGGTKFYERKEIKDLL
FT                   AYLRVIQNPQDDISIKRIINVPRRGIGLRTIEKIEDRANLKQESIYSVLIDIETNSDIS
FT                   TKARASISGFVDIIGTLRTIKEVYPVSKLIEKVLDTTGYMDELVEIRNKNEKDLTGKGE
FT                   EAQDRIDNLREFISIALEFESSNDDTYENKDLETFLTSIALTSESNDEEDNDRVSLMTI
FT                   HTSKGLEFPVVFLTGMEEGLFPISRAIKSMSDSQIEEERRLCYVGITRAKEELYMSLTE
FT                   KRTLYGKTNVAIASRFMEELPEECIERLYKVKKELSYSKASYNMLDKYTKKYMSTISKS
FT                   KVADKVNATIKDSNKETNPDDIKLGSKVHHPKFGVGTVVSIIGTDVTIAFDQQGIKKIN
FT                   KEYTTLNIL"
FT   CDS             397864..399162
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0334"
FT                   /product="putative aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02041"
FT                   /db_xref="GOA:C9YIE1"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE1"
FT                   /protein_id="CBE02041.1"
FT                   /translation="MDSINFAKNLIDFIYDSPSSFHAVESTKEILDKNGFEELVLNQRW
FT                   NLRVGGKYYVTKNLSAIVAFVVNSEDIERDGFRIIGSHSDSPTFSIKPNAEIEAEKSYL
FT                   KLNTECYGGAILSTWLDRPLGIAGRVVLKGDSILKPNERLIDFKKPICIIPNLAIHLNR
FT                   SINDGHSYNKQKDMLPLVGMLNDTLEKDNFLIKQIASNLDVNMEDIIDFDLFLYEFEKG
FT                   SLIGANDEFISIGRQDNLAMVHASLNALVNTKGQQGVNVMAVFDNEEVGSSTKQGADSN
FT                   MLLNILERICISMGKDREGFFESIYSSFMISSDLAHAIHPNIPEKHDPTNKPIMGKGPV
FT                   IKINASQAYTSDGYSIAIYKNICREVNVEYQEFVNRSDERGGSTIGPISSTHIDIPSVD
FT                   VGSPILAMHSIRELGNVEDHYSIYKTFSKFFEI"
FT   CDS             399193..399945
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02043"
FT                   /db_xref="GOA:C9YIE2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE2"
FT                   /protein_id="CBE02043.1"
FT                   /translation="MKLGLCLEGGGAKGAYQAGVVKALYDGGINKFYSISGTSIGAING
FT                   YYLYTGNVDNLEKMWTNIKDIQNGNVKIVNNTVDNSPAIDNLRELDDSNIEEMNFYVNY
FT                   VEVDNKVVSEKIVDISKMPRNEAIISISYSGLLPSNPNATLGFKEQFVKDVQEGIYDGF
FT                   KLDGGLIRSALIEPLIGDNVDKIILISTKYNYELPEDIKKVYDEDKIIVVRPNTQFAPK
FT                   DTLNFDDEFCKTIYQEGYEIGKNILDRL"
FT   CDS             400010..400534
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="CDR20291_0336"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02044"
FT                   /db_xref="GOA:C9YIE3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE3"
FT                   /protein_id="CBE02044.1"
FT                   /translation="MENKNPIVTIEMENGKEIKIELYPNIAPNTVKNFVSLVNEGYYNG
FT                   IIFHRVIPGFMIQGGCPNGTGMGGPGHSIKGEFSGNGFTNNLKHERGVISMARTMAPNS
FT                   AGSQFFIMHKNSPHLDGQYAGFGRVIEGMDTVDEIASVRTDSADKPQTPQIMKSVTVET
FT                   FGIDYSDVEKN"
FT   CDS             join(401359..401952,401953..402312)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0337"
FT                   /product="putative exosporium glycoprotein (pseudogene)"
FT   CDS             complement(402547..404145)
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="CDR20291_0338"
FT                   /product="manganese-dependent inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02047"
FT                   /db_xref="GOA:C9YIE4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE4"
FT                   /protein_id="CBE02047.1"
FT                   /translation="MSLLVFGHKNPDTDSICSAISLAHLKNKLGIKATAYALGDIRKEA
FT                   KYALDYFKVDAPEILDNVRIQVRDLNYDKVVPLTPTSSILEAYNLMDEKNVKTLPVTYD
FT                   DGTFAGIITMKEIAKNLLHQHFTTIHTSLSNICKNLNGTILVDCGEDIKGRVVTLSFGM
FT                   ETLIETLKEGDIAIVGDRYDSIEYAIDTKVKLLILTNHTEISKDLLALAKINGVSVVSV
FT                   ESDNYKTSNVINQCSFLDSIEATENLITFKEDDYMDEIKEIMLETNFRSYPILDDDNKF
FT                   LGLVSKGHLLNPSKKNVVLVDHNEYAQSADGIEQANIVEIIDHHKLGGISTDVPMSFRV
FT                   MPVGCNSTIIYQMYKENNVEIPYEIAGLLLSAILSDTLLFKSPTTTDMDKKACEELSKI
FT                   AKVDMEKYAMDMFKCGTSLDEYTIEEIVNMDFKEFNMSGHRVGIGQVFTLDIDSIFAKK
FT                   DEFLSYINSTDYDKLILAVTDIIKEGSYLIYKAEDSLIANAFDVEGVQGTFAPGVVSRK
FT                   KQLVPNLTTAIKNFK"
FT   CDS             404993..407665
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="CDR20291_0339"
FT                   /product="aldehyde-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02049"
FT                   /db_xref="GOA:C9YIE5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE5"
FT                   /protein_id="CBE02049.1"
FT                   /translation="MHNYFREVFSMEKKEKVVEKSNVEVCSPEIVNSVETLRMRLEEIR
FT                   LAQKEFATFTQEQVDKIFLAASTAANQQRIPLAKMAVEETGMGIVEDKVIKNHFASEYI
FT                   YNAYKDTKTCGVIEKDEAFGFTRIAEPVGVLSAVIPTTNPTSTAIFKSLIALKTRNGII
FT                   FSPHPRAKNCTIEAARVVHDAAVKAGAPKGLIGWVDVPSIELTNVVMAEADLILATGGP
FT                   GMVKSAYSSGKPAVGVGPGNVPAIIDESADIKMAVSSILVSKSFDNGMICASEQAVIVP
FT                   EKIYEEVKKEFKYRGAHFLNKEETEKVGKVVIIDGSLNARIVGQPAHVIAKMADVEVPK
FT                   TARIIIGEVESVELNEPFAHEKLSPVLAMYKSKSFEDAVAKAEKLVADGGYGHTSSLYA
FT                   DSINHPDRVEKFVNAMKTCRVLVNTPSSQGGIGDLYNFKLAPSLTLGCGSWGGNSVSEN
FT                   VGVKHLLNIKTVAERRENMLWFRAPEKVYFKKGCLGVAAREFKDVMDKKKAFIVTDSFL
FT                   YNNGYTKKLTDLLDEMGIKHTTFFDVAPDPTLACAREGAKAMADFQPDLIIAVGGGSAM
FT                   DAGKIMWVMYEHPEVDFQDLAMRFMDIRKRVYVFPKMGEKAYFAAIPTSAGTGSEVTPF
FT                   AVITDQDSGVKYPLADYELMPNMAIIDADMMMEMPPRLTAASGVDALTHALEAYVSMLR
FT                   TEPADGLALQAGKIIFEYLPRAYKNGKNDKEAREKMAMASTMAGMSFANAFLGICHSLA
FT                   HKLGAFHHVQHGVANALLINEVIKFNCAEAPNKMGAFSQYRYPDCIQRYAEFASFAGIK
FT                   GNTDQEKVDNLIKAIDELKARVGLPKTIKEAGVEESKFLETLDVMVEQAFDDQCTGANP
FT                   RYPLMSELKEIYLKVYYGK"
FT   CDS             complement(408025..408366)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02051"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE6"
FT                   /protein_id="CBE02051.1"
FT                   /translation="MLLILDNLNLNLDFDYRIIREENDDVDIFIDINYRSLDIDTDGSN
FT                   LFNSRIQFPFVRALILRINKNNQCMTIHLLRDIDLFSAFANFEVDYTDSIINIKNQNEK
FT                   VILNKSIKK"
FT   CDS             complement(408393..409064)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0341"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02053"
FT                   /db_xref="GOA:C9YIE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE7"
FT                   /protein_id="CBE02053.1"
FT                   /translation="MPILEILNLGKIYGKKETAVHALKDANLKINKGEFVAIIGPSGSG
FT                   KSTFLHLVGGLERPSSGTIKVDGKDICCLSDKKLAKYRRQKVGFVFQQYNLIPVLNVKE
FT                   NIELPLKLDNKKVDEEYIEDIINLLGLSERKNHLPNQLSGGQQQRVAIARALSAKPSII
FT                   LADEPTGNLDSKTTEEVMDLLKSSIKKYNQTLIIITHNENIARKADRIISIIDGELKLT
FT                   L"
FT   CDS             complement(409076..411661)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0342"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02054"
FT                   /db_xref="GOA:C9YIE8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE8"
FT                   /protein_id="CBE02054.1"
FT                   /translation="MKDNLKIALRYIISYKARSLAIALSIILATSLIVGIGTLSRSAQQ
FT                   AEVDKLKRETGSDHVYFKDINKNQLEYIKSRKDIKNLGITSHYGYTDPNERLAINLEYA
FT                   NKNYLTNQSKLIKGHLPKASNEVVVEKWILNSLGLKPEINQNITFKLYQKEKPETFKVV
FT                   GILEDRPIEKNKGTCEIFLNLNESKLDKFSYAYIEFNNGIDINTSIDNIVKNTMLDENS
FT                   VGKNKMLIESTRENGTLDNSSKYTAITMSLFSGIVIYSIYVISIYQRIQEYGILRAIGS
FT                   TNFKIFKFMFYELFILALIAIPIGICTGIGGAQIFNRTAGNIQFEGNVTVTPFVIPDKI
FT                   ILLSIGSIILTILIISFFTYLKIRRISPIDSIRKTFGTDKNINKVNSLISKLTLNISVT
FT                   KSISAKNIFRNKKGFIIIILSMSLGGIMIIKENYKYSFSDIQNKNGQEETYMNADFILT
FT                   NFFLKLNQSNKADSFKDIKGLNDNQIDKIKNINGIDKVKTASILDTRIEVDKLNGLDYY
FT                   NIINSTPYYKDFPLFIKNKNTGKYTMKQKLRGYNDEMINSLEKYLVSGSINLERMKKEN
FT                   LAILYVPQVSKTNKYKLSYTPGTETPAVDIKVGDTIKVKYPKGEIDQDLYIKLKDNYEY
FT                   LEYEFKVGAIVSYPFADNYLYSGDQGIDVITSNDYLKKLTGVDKYNVVYVDINKNANVK
FT                   KINTLLGEIGSESPGTTTANMLMEKENFDKMTARALTYAYGIVAVMFIISVFNIINNIS
FT                   YNLTSRTSEFGMLRAIGISERGFKNMILYEGILYGILSSVITIVVGLIIQFRMYYTYNF
FT                   VSYGLGFSIDYKIYILVVLANIIVGILATYIPLRKINKISIVEAINITE"
FT   CDS             411869..412804
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0343"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02056"
FT                   /db_xref="GOA:C9YIE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIE9"
FT                   /protein_id="CBE02056.1"
FT                   /translation="MENNFIFPIVILTLFIFSNLIMNKYRFYKELDILKRGILTFFVSC
FT                   FVWILFMEGIEYIQLSLGYNFLLEGVLNIILFLILIILSFYIGFKFIRLLDNNNKQEYK
FT                   LQKLDSKINHKDNIIVKLRSQKHDYLKHLQVVYSLLNTGLAEDAKEYITNISNSFKSKN
FT                   SRYGKVSYLDAIASLKYEECLEKNISFDVYIQDFMDNLEIEPNDMSSVLLNIIDNAIES
FT                   LSAIQKEKKYIRLHAYEDEFQYIIAIKNNGPKIHNVESIFLDGFSTKEGQDRGFGLYLV
FT                   KNILDKYDYSILVNSDDFLTEFVILIPKYY"
FT   CDS             412823..413560
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0344"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02058"
FT                   /db_xref="GOA:C9YIF0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF0"
FT                   /protein_id="CBE02058.1"
FT                   /translation="MIKVLICDDDKIVRDDIANIVKESGYVDYVKKVKDGIEAIEFIKS
FT                   EKIDLLIIDIDMPYKNGIDSAKEILSIDKDIHIVFVTGFADYSLESFKVHPIDFIVKPF
FT                   KKEKILDSINIAIDHINSHKIAKNNFIEDTLFVYKIRKQIHMINFDDIVMFEKNSRAIN
FT                   LYTRDEDTIKFYENFDDLKKRLPPNFFMTHRQYIVNLRLIHKVIPINKSSLEIKFINFQ
FT                   ESATLNKSLEKDFLYRFYRVKRF"
FT   CDS             complement(413720..418777)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0345"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02060"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF1"
FT                   /protein_id="CBE02060.1"
FT                   /translation="MLERTRVEKNPKIIENFKNNFTKSSSKQYYDLAKSLWDCIENSSY
FT                   YYREPEDKFLNMIKKYYNCHYYEIKNMDELLSGPLKNALELIFTSEQVEELCQLIKRKM
FT                   DYTYSGGYYRKGYRSNKLVDYFRGIIRFISNYVDLIYYDFSVIDYLTLPNKVLYYDSIM
FT                   SDKIALEIDKGNQKVTSALEEVIFGENQTALLTRQMIIGIMKSHSDKCYEMLSKLLLAA
FT                   KQQEGLRQQIVESLDEGTISASIYMLKTILDNNLERFSSVIRALDTWTGLGFSDQKPGI
FT                   IRKCLELSYKSLTDEKFRIESINSNDNLEIYFALWATATYNIYDSYSLIENLLSCQEKY
FT                   KKLVALYFLSHTESTYFKHSIASKNIKGDDLEILAWVITNFYVEGSVGYYYSWQNRETN
FT                   FDLSNTPIDKDFDARKEQFESLKHTLEILNSKTKSFSGSVFPWTWIEISSHEILKCMMT
FT                   LTAYDMNAQFIDVLMENCHLMSSDLRASLIVNFVNEPKTDRQREFLLECLSDKSVSNRE
FT                   TVLSLLRKLELTDVELDKITNLLSLKTSSIRQTVIKILLEQDDSNLENIASSLIKSSNS
FT                   QKCLGGLEIVNLLKDNSDRQELYNKLILLIEDIDKSKKNTSQVQILIDNLLGKAKNDYC
FT                   KENGFGIYNPENKVQIPEQFDFKDDSNSSSKLNKIISNISLSTSEDSVSVATKKEAKKI
FT                   LDTDINKIIKVYEKFDELITENADYEYEVERWSGNVDKVLLGYSTYNLTPIKYKVSNDT
FT                   LDNYPLAELWRETSKKLDLDYKLILDILFYSISTCGYNETEKSWFSSIYSNVLDSKKQN
FT                   KIYTKLEKFKFNGLTRKLLRVLLNEFDHKEIFNYCLEIYYKLRNLLTIEQCKKQRVEFT
FT                   KNYYRQNEYCPALNAPILNYWLDKAHSFIYDDISFTKFFYTTFSNYQLLEYKFPFYTSI
FT                   NVFARAHELGLMTEEQVNREMISGYNASNIIRTLTNPRWAGDTLEKYPWLKDNLKTVTN
FT                   RIIEIESRRGDMPTEVSHLANNIQYFEGIDYFVNILVALGKETFQRGYSYGSNYSKKDV
FT                   LSSLLKNCYPTKEDDSKKLKSLLKNTDITELRLIESAMYAPQWVNIIEKYLNWKGLKST
FT                   IWYFHAHINEGFSAQKESEVALFSPISPRSFIDGAFDVDWFLDSYKTIGEERFNILYKS
FT                   AKYITSGGNSHRRAQLYADATLGKLDKDMLMKEIETNRNQDKLRSFSLLPMKKGDLKEA
FT                   TFRYEFIQKFAKESKQFGAQRRESESKACTIALENLARSAGFGDVNRMMWALETEKLNE
FT                   VAHLFKPKDIDGTSIWIDVDESGKASTKVQKGNKSLKSIPKAIAKHPYVLELKSVQKDL
FT                   KSQYSRAKQSLEQAMKNEIVFTVKEIANIYKNPVICPLIKNLVWVCDDNIGYVYNDKSK
FT                   FFICNIEGETYKLTAKNKLKLAHPVHLFESGKWSEFQHDLFSKQLVQPFKQVFREYYRI
FT                   NSDEISEKTISRRYAGHQIQPKKTVALLRNQLWTVDYEEGLQKVFYKENIVAKMFALAD
FT                   WFSPADIEPPTIETVEFFDRKTYKSLELASIPPILFSEVMRDIDLVVSVAHAGGVDPET
FT                   SHSTVEMRIAIAKELLLLLKINNINFEGSHVLITGNLGEYSVHMGSGIVHKKGMGALNI
FT                   LPVHSQSRGKIFLPFADEDPKTAEIMSKILLLAEDNKIKDPSILSNL"
FT   CDS             complement(418802..419221)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02062"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF2"
FT                   /protein_id="CBE02062.1"
FT                   /translation="MQIYFRVKAVGKRKPMLELTPFDVSDNINCLKEAISEIVSKNVLE
FT                   YNEKIPEKSIINFLTNEEIESQADIGKVGFGSIYNENKQSVEKAIEVALQAFEDGIYKV
FT                   LINEDVIEKLDSPINLKSGDIFTFIRLTLLAGRMF"
FT   CDS             complement(419454..419705)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02064"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF3"
FT                   /protein_id="CBE02064.1"
FT                   /translation="MNRYTKIINMMGSYYTKDFEKEKKNVIKVREVKEDTVRKFFLQGD
FT                   CEVLVVFEDTGKEILIDDFSPEEDIKKYLGTKFINKKR"
FT   CDS             419794..420525
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02065"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF4"
FT                   /protein_id="CBE02065.1"
FT                   /translation="MTSIKNKDILNCIDYSIKNKLFDKLNDVYKSLPVGNCSGCGNCCM
FT                   ESVGINLIEFLNIFCYLEDRVDLKKSCISKILDYYFEEYTRKNPCPFKDTNNRCLIYEV
FT                   RPLNCRMFGHWKKEDYNKNLDNVIEKNNNYRELMKKQYGFEINDEVVNYRIDYCDRFIP
FT                   NKDYLSKSKRLSFFDELMILDSNIYSSGNIDIDFRDRGIVEYFIESLLYRNLAYNVKIR
FT                   ISKEYKIRKRTIDRIKRIVLV"
FT   CDS             420512..421495
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0349"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02067"
FT                   /db_xref="GOA:C9YIF5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF5"
FT                   /protein_id="CBE02067.1"
FT                   /translation="MFLYSFILVSNKLYHKYCQNEVRKVNLTKVKGNTFFIKGGTNTGI
FT                   YVFEDNTALMIDPGLCGSRPRRVNKVLDENNIQVRYIINTHGHDDHYGACNQFKEYYKD
FT                   VCIMSSEYDKLYIENPELFSKYIVGGKSNVFMDNILKNKMLDDIKIDKSIEVGKIELNN
FT                   EMFDIIEFQGHTPGSIAVLTKDNVIFVGDLLIGDEILSKYDFLFLYDIQEQINSLEKLK
FT                   NIDFEYLVLGHGKQVISKEDSYKLIEKHLNALKKYLYQIRELLVEPKSLEILLKNIINN
FT                   NNLSNNYKEYHFFKSSLVSVISYLVDLEEIGYILENGELLYYTKTK"
FT   CDS             421546..422358
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0350"
FT                   /product="putative guanosine 3',5'-bis-pyrophosphate
FT                   (ppGpp) synthesis/degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02069"
FT                   /db_xref="GOA:C9YIF6"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF6"
FT                   /protein_id="CBE02069.1"
FT                   /translation="MEYEKWNEILAPYEHAVEELKIKFKNIRKEYLAKGEYSPIEFVTG
FT                   RTKKISSIISKLKRINAKDIETEIDDIAGIRIMCQFVEDIYAIVDLIKVRNDMTIIGEK
FT                   DYITNYKDSGYRSYHVIIKYPINSIAGSKEIICEIQIRTLAMNFWATIEHSLKYKYDHY
FT                   IPETLAERLRRASDAAFLLDQEMSEIREDIMKAQAMYQMKSIAIRDTLNRIQELYDLGD
FT                   THKAMQYQRKLDRTETDKNITEILELKQEIDILLEQYKDTKVDDKVVQ"
FT   CDS             422468..423160
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0351"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02071"
FT                   /db_xref="GOA:C9YIF7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF7"
FT                   /protein_id="CBE02071.1"
FT                   /translation="MSLYAIGDLHFSTSVNKPMNIFGSNWDGHEKKIIDNWKEVVKEED
FT                   MVLVLGDTSWGINLSEAKKDLDIISKLPGQKILIKGNHDYWWTTVTSLNKLYEDMRFIQ
FT                   TNFYEYKDYAICGGRGWICPNDVKFDETDEKVYKREEHRLRLSLESARKSGHSKIIVIT
FT                   HYPPTNDKLEESLFTKLFEEYNVEKVIYGHLHGKESFKMGLKGIRNGVEYTLASCDYTE
FT                   FNLIKVHD"
FT   CDS             423247..424188
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0352"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02073"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF8"
FT                   /protein_id="CBE02073.1"
FT                   /translation="MRWILVFIFLYLIPLVVIFRNYKNFKRSCIYSSIYVVLATTIMIS
FT                   NIYMSGLNKIKESMYYHNYISDETYDEKYVSNFKEKESTDLKQDNKKNEEISNNKNLNN
FT                   KQDRNIQNKESNEEGSNDIKEKNNSDSNVSVNNKSEKQEDNTKENNKYTSKEKNSEDIK
FT                   KIDMESIGIFKKEIYNIERAALVPMRECIPYTKDIAKNITKLSSIKKDVTNARNKCKEV
FT                   VKEYENMQIPELSKEKYTETLSNARDDVKKAYELREKSMESALKLINTKSPKYIGKITE
FT                   YLDLSDKQIESFKNRLNDLKEEINNSETNNIN"
FT   CDS             424222..425382
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0353"
FT                   /product="conserved hypothetical protein"
FT                   /product="sam dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02075"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIF9"
FT                   /protein_id="CBE02075.1"
FT                   /translation="MMNKQSIGKLNMFFMGITQRNLDNRHFFIELEVIFKSGRKEFKGI
FT                   AIEEDNKYKFNFKGKSDLYTFNELLKNISKEAENYDGLVFKYVERGTIVVIEGDNKKVN
FT                   VKYLDNKEEVPKIDEFTASQIKNRDYYVKVGQANALLKEIGVLTKDGKIKNDKIRKYNQ
FT                   IDHFVELIDSILKEIKDKDCITILDCACGKSYLSFVLNFYIKEVLKKNCYFIGIDYSDV
FT                   VIEASKNMAKNLGYKNMSFIKEDLTNYTPNRDVDLVISLHACDTATDMAIGLGIRAKSE
FT                   AIVVVPCCHKELLGQYRYEAMEPILKHGVFKARFADLITDGLRTLLLEGNGYDTSVVEY
FT                   ISPLDTPKNLMIRAIKTKTNNDKALKEYKELKSQFGVEPTLEKLIY"
FT   CDS             425522..426094
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02076"
FT                   /db_xref="GOA:C9YIG0"
FT                   /db_xref="InterPro:IPR009206"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG0"
FT                   /protein_id="CBE02076.1"
FT                   /translation="MEVKMNKLNICIDIDGTITSPYHFLPYLNDIFNKNITEAECITHN
FT                   WEELYGSGIRDVYAEFNNKYIHSYDEAKIVEGATEVISTLSKGHNLSFVTARHECLTDV
FT                   TKNWLSRQGFSDIDVYLLGSDYKVEKARELSCDIFIEDNPLNSVQLADDGVKVILLDTN
FT                   YNKDVKHQNIVRVSNWIDIEKIIKQGI"
FT   CDS             426122..426613
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02078"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG1"
FT                   /protein_id="CBE02078.1"
FT                   /translation="MIDLKIENRKGKIHVKSSEIKDILELRPDFEYVQDISNTINQENI
FT                   LVFDCQLTGNSFDMDDLDIEEILEELGEEIDESYFSVLFEDVRAYLKDATDEIEADLQD
FT                   NYLFDNLRCYFDIYNINQEFTDFKFVFLVSFKDIKISSLANLAKIVSKRQLIGASKFYS
FT                   "
FT   CDS             426842..427393
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0356"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02080"
FT                   /db_xref="GOA:C9YIG2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG2"
FT                   /protein_id="CBE02080.1"
FT                   /translation="MQSLNEIIAENLKKIRKEKHLSLDKIAQLSGVSKSMLSQIEKCEV
FT                   NPTISTLKKITNGLKISFTSLMERQESDIELIQKSDIDHFIEDNGKYISYPIFPFDSKR
FT                   RFEIFMIEIEEGGNLDSNAELPGTQEFITVFSGEVTIKINGEDYIVSSGNSIRFKADVS
FT                   HIYRNSGKGIAKMSMVVYYI"
FT   CDS             427479..428411
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02082"
FT                   /db_xref="GOA:C9YIG3"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG3"
FT                   /protein_id="CBE02082.1"
FT                   /translation="MNNKKAVFFFCSDLKKDPVASNVIKCCEEIMDLNQTDIVIDDNFV
FT                   LEFKDKNNNLFHFVKTKDVISHNYKYYLPILNRHFRDYDFAGVVNWHEGENAPEHILTA
FT                   HTIGDVPTGEFGNSNPRYFKNLINAIEDIKNENLLDEFTTLTEATHWSGTTYGEESKLI
FT                   TEYSVPMLDIEIGSSSDSFNNSIAIQVLAKSLIRVFDCDEPLKTLLCVGGVHFEKSFSD
FT                   IIKNKEYNISIGHVLPNQWIVSGMYDDESGFEKLEKCINSIEGGIDCIVFHDKLKGTYK
FT                   EQCRKLGEKLNVPVFKHKILKNPKDLPIW"
FT   CDS             428466..429329
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0358"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02084"
FT                   /db_xref="GOA:C9YIG4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG4"
FT                   /protein_id="CBE02084.1"
FT                   /translation="MILSYFALLIRVVLLAFERVVVRLLGDEEGDIYKNIASSFLFFFI
FT                   GGVCLLPFSIMDRVSDWSFLIPCYISSLVYSIGSVAYVTSLATGEVSLVTPINSLNSLF
FT                   LLLLSVIFLGEGLSLAKVAGIIIMIGGVFILKKVSSFLKNVSVIFNNLPCRLMFLYIFL
FT                   QSVGRVLDKAFFVQVSPILYSTILYFFVGLNLFIFLAFKKKQKIICEIFSNKKGLSILS
FT                   GAINGYSYLALLIALNNLELSIAEPFSQVSMIITLILAHFIFKENIKEKIPGSILILIG
FT                   GWLLLL"
FT   CDS             429576..431438
FT                   /transl_table=11
FT                   /gene="bglF"
FT                   /locus_tag="CDR20291_0359"
FT                   /product="PTS system, beta-glucoside-specific IIabc
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02086"
FT                   /db_xref="GOA:C9YIG5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG5"
FT                   /protein_id="CBE02086.1"
FT                   /translation="MNYKKTAIDIIEQVGGSKNILALEHCSTRLRFKLIDRSKVNQDAL
FT                   KKVQGVMSIVNGAQFQVVIGNSVVDVYDEILKVCPLDTNDSTVKTEEKINLGTRFIEFI
FT                   INIFQPLIFAIAGAGILKSLLMLLAMFNILKSDSTIYTLLVAISDATFYFLPLMVAVTT
FT                   ANVLKCNRLVAIAAVGYLLLPATTTALSEGVELFGFTIPNIAYNAQVFPAILCVSFLAT
FT                   MEKIFNKYSPKPIRTFFVPMMSLAITVPITLTILGPLGYNVGTIFTTIILFLYNKMGFL
FT                   VVGLLAAFLPFMVATGMHKALIPYSINTIGKLGYEALYMTSSLAHNISESGACFAVALR
FT                   TKDETLKQTALSAGISALMGITEPALYGITLQHKRAMLGVVFSSAISGTFLGLFAVKGF
FT                   VIVGPGLASMSMFIDPNNGNNLIFASIGFVIAILGSFIITLIIWKEDTNTVESSIGDVV
FT                   EEELEEEKEVNILVTPVEGKVIDLSKVNDELFASKTLGDGVAIIPTNGNLYAPCDSEVV
FT                   MLFETKHAIGLRTKNGAEILIHIGINTVSMNGDGFKTFVKTGDNVKEGDLLIQFDLDKI
FT                   SHANLDSTVMIVNNNGADYAYKVLNQSYGNVKKGSILFDVKGGI"
FT   CDS             431441..432907
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="CDR20291_0360"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02087"
FT                   /db_xref="GOA:C9YIG6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG6"
FT                   /protein_id="CBE02087.1"
FT                   /translation="MRKFPEGFLWGGATAANQFEGGWNLGGKGWSVSDVAKAHFDADVK
FT                   DYKSNNEITTKDIEEGLAHPEDEVNYPKRHGSDFYHHYKEDIALMAEMGFKTYRMSIAW
FT                   SRIFPNGDDKEPNEEGLQFYDDVFDELISYGIEPLVTMSHYEPPLNIVLNYDGWYSRQV
FT                   INMFVRYVETICERYKNKVKYWLTFNEVDSMIRHPYTTGGLVRDRFKDKNFEEVIFQAM
FT                   HHQFVASALATKICHEIIPNSKVGCMLTKLTYYPYTCRPEDVLATQQKMRSIYAYSDTQ
FT                   VFGEYPVYLLSYFKNNNIQIAKEEHDDEIMKKYPVDFISFSYYMSSCEAADTTGLDITP
FT                   GNTLLAVKNPYLEMSEWGWQIDSIGLRISLIELYDRYRKPLFIVENGLGAKDILTEDKK
FT                   VHDQYRINYLKEHFKCMLDAIIEDGVELWGYTSWGCIDLVSESTKQMSKRYGYIYVDAD
FT                   DYGKGTYNRYKKDSFYWYKKVIENNSIDFK"
FT   CDS             432931..433767
FT                   /transl_table=11
FT                   /gene="bglG"
FT                   /locus_tag="CDR20291_0361"
FT                   /product="beta-glucoside bgl operon transcription
FT                   antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02089"
FT                   /db_xref="GOA:C9YIG7"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG7"
FT                   /protein_id="CBE02089.1"
FT                   /translation="MNYIIKKVLNSSVVLVHDAKYNEFILLGKGIGYGKKTGEYICGSN
FT                   DNQMFVPVENTKSKKFLELMDDIPVDILKITQEIIVEAEKLLNSSFNKNLYLILADHFN
FT                   FAIERMRKGIKITNRVFWEIKNYYPNEFKVGMVAIYMVEERLGIQLPEEEAANIAFHFA
FT                   NAMASDGNSYDTIKYAKVIGEIINIFVFSLNRTLDKKSMHYMRFITHIKFFVERFFSDS
FT                   MLSSGDDLLFNQMKRSNPKEMLIALKVRDFLEKKYGKKLTNEEIAFLVVHIARVKQ"
FT   CDS             434333..435916
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0362"
FT                   /product="asparagine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02091"
FT                   /db_xref="GOA:C9YIG8"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG8"
FT                   /protein_id="CBE02091.1"
FT                   /translation="MINLEEKYLTRKDTYMIKILEYNGHIRNWKVLCEELGIDSSLCRD
FT                   ERERAILVEAYKTWGYDMANHMHGMFAFALWDTVEKKLFCLRDQFGVKPFYYYETENGK
FT                   LLYGSSIRKIMEQPGFVKELNEDMLQIYMSFTYVAGENTFFRGVKKLMPGHYLVYQNKT
FT                   VCIGRYWKPEFHPDHSKSIEEWTDEIHTTLQKIMPEVKSENETAELFLSGGVDSSYILA
FT                   MSDIEKTGSCGYEEERFDESKLAQQTANILGCKNSRYIITPEEYFASVPYVMYHMEQPT
FT                   GDASAIVFAIGCKAAAENTNICYSGEGADEFFGGYNIYHKAECYGENLKTFYIGNTNIM
FT                   NEGEKRKILKKYNPDVLPIEVVKGIYEETEELDTLTNMSNVDIQIWLEGDIYFNIDKMS
FT                   TAVGLEVRMPLTDTRIFDIASRIPSEYKVKGKENKIAFRTAASKTLPEEIAFRNKLGFI
FT                   VPIRIWMADDQYNKDIRDKFNSEIADKFFNIDEINEIFNDYISGNSDNWRKIWMIYTFL
FT                   VWYEIYFVKC"
FT   CDS             complement(435981..436577)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0363"
FT                   /product="Radical SAM-superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02093"
FT                   /db_xref="GOA:C9YIG9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="InterPro:IPR023822"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIG9"
FT                   /protein_id="CBE02093.1"
FT                   /translation="MNILYTIENSIYVNITNTCPCSCVFCIRNEKDEVANSGSLWLEHE
FT                   PSVDEVKEAFNKYNLDDYDEIVFCGYGEPLMRINELIEVAKFIKEKSSIKIRINTNGLS
FT                   DLIHNKKTAILLKDVIDTVSISLNAPNKEAYNRVTQPKFGEKSFDYMLGFARDCKKYIK
FT                   EVAFSVVDEISPEEIEESKQLAKKLDIPLRVRHKN"
FT   CDS             complement(436604..437122)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0364"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02095"
FT                   /db_xref="GOA:C9YIH0"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR023812"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH0"
FT                   /protein_id="CBE02095.1"
FT                   /translation="MNKVTSKKTTYIVTSALFASIICLTIAYILHIPVGGNNGYVHIGD
FT                   AFIYLAATILPTNYAIAASAIGAGLADLSTGAAIWVIPTIIIKPILVLFFTSKSDKIIN
FT                   KRNIVASVVAGIVGLVLYMFAEGIIIGSFTSAFVMSLLGLLQPIGSFIVFIILGMALDK
FT                   LDFKKRYFN"
FT   CDS             complement(437493..438491)
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="CDR20291_0365"
FT                   /product="(R)-2-hydroxyisocaproate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02096"
FT                   /db_xref="GOA:C9YIH1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH1"
FT                   /protein_id="CBE02096.1"
FT                   /translation="MKILVFGARDYEEPVIKKWSEEHKDVQVDIYPENMTEENVVKAKG
FT                   YDGISIQQTNYIDNPYIYETLKDAGVKVIASRTAGVDMIHFDLVNENGLIVTNVPSYSP
FT                   NAIAELAVTQAMNLLRKTPLVKKKVCEGDYRWIAELLGTEVRSITVGVIGTGKIGATSA
FT                   KLFKGLGANVIAFDQYPNSDLNDILTYKDSLEDLLKEADLITLHTPLLEGTKHMINKDT
FT                   LAIMKDGAYIVNTGRGGLINTGDLIEALESGKIRAAALDTFETEGLFLNKKMNPGELTD
FT                   PEINKLLSMEQVIFTHHLGFFTSTAIENIVYSSLSSAVEVIKTGTATNRVN"
FT   CDS             439168..440367
FT                   /transl_table=11
FT                   /gene="hadA"
FT                   /locus_tag="CDR20291_0366"
FT                   /product="isocaprenoyl-CoA:2-hydroxyisocaproate
FT                   CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02098"
FT                   /db_xref="GOA:C9YIH2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH2"
FT                   /protein_id="CBE02098.1"
FT                   /translation="MLLEGVKVVELSSFIAAPCCAKMLGDWGAEVIKIEPIEGDGIRVM
FT                   GGTFKSPASDDENPMFELENGNKKGVSINVKSKEGVEILHKLLSEADIFVTNVRVQALE
FT                   KMGIAYDQIKDKYPGLIFSQILGYGEKGPLKDKPGFDYTAYFARGGVSQSVMEKGTSPA
FT                   NTAAGFGDHYAGLALAAGSLAALHKKAQTGKGERVTVSLFHTAIYGMGTMITTAQYGNE
FT                   MPLSRENPNSPLMTTYKCKDGRWIQLALIQYNKWLGKFCKVINREYILEDDRYNNIDSM
FT                   VNHVEDLVKIVGEAMLEKTLDEWSALLEEADLPFEKIQSCEDLLDDEQAWANDFLFKKT
FT                   YDSGNTGVLVNTPVMFRNEGIKEYTPAPKVGQHTVEVLKSLGYDEEKINNFKDSKVVRY
FT                   "
FT   CDS             440397..441206
FT                   /transl_table=11
FT                   /gene="hadI"
FT                   /locus_tag="CDR20291_0367"
FT                   /product="activator of 2-hydroxyisocaproyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02100"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH3"
FT                   /protein_id="CBE02100.1"
FT                   /translation="MLKMYTMGLDIGSTASKGVILKNGEDIVASETISSGTGTTGPSRV
FT                   LEKLYGKTGLAREDIKKVVVTGYGRMNYSDADKQISELSCHARGVNFIIPETRTIIDIG
FT                   GQDAKVLKLDNNGRLLNFLMNDKCAAGTGRFLDVMAKIIEVDVSELGSISMNSQNEVSI
FT                   SSTCTVFAESEVISHLSENAKIEDIVAGIHTSVAKRVSSLVKRIGVQRNVVMVGGVARN
FT                   SGIVRAMAREINTEIIVPDIPQLTGALGAALYAFDEAKESQKEVKNI"
FT   CDS             441215..442447
FT                   /transl_table=11
FT                   /gene="hadB"
FT                   /locus_tag="CDR20291_0368"
FT                   /product="subunit of oxygen-sensitive
FT                   2-hydroxyisocaproyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02102"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH4"
FT                   /protein_id="CBE02102.1"
FT                   /translation="MKMSEKKEARVVINDLLAEQYANAFKAKEEGRPVGWSTSVFPQEL
FT                   AEVFDLNVLYPENQAAGVAAKKGSLELCEIAESKGYSIDLCAYARTNFGLLENGGCEAL
FT                   DMPAPDFLLCCNNICNQVIKWYENISRELDIPLIMIDTTFNNEDEVTQSRIDYIKAQFE
FT                   EAIKQLEIISGKKFDPKKFEEVMKISAENGRLWKYSMSLPADSSPSPMNGFDLFTYMAV
FT                   IVCARGKKETTEAFKLLIEELEDNMKTGKSSFRGEEKYRIMMEGIPCWPYIGYKMKTLA
FT                   KFGVNMTGSVYPHAWALQYEVNDLDGMAVAYSTMFNNVNLDRMTKYRVDSLVEGKCDGA
FT                   FYHMNRSCKLMSLIQYEMQRRAAEETGLPYAGFDGDQADPRAFTNAQFETRIQGLVEVM
FT                   EERKKLNRGEI"
FT   CDS             442447..443574
FT                   /transl_table=11
FT                   /gene="hadC"
FT                   /locus_tag="CDR20291_0369"
FT                   /product="subunit of oxygen-sensitive
FT                   2-hydroxyisocaproyl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02104"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH5"
FT                   /protein_id="CBE02104.1"
FT                   /translation="MEAILSKMKEVVENPNAAVKKYKNETGKKAIGCFPVYCPEEIIHA
FT                   AGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLIC
FT                   LGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHES
FT                   IEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAM
FT                   PEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERL
FT                   ARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIE
FT                   DSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSLA"
FT   CDS             443622..444755
FT                   /transl_table=11
FT                   /gene="acdB"
FT                   /locus_tag="CDR20291_0370"
FT                   /product="acyl-CoA dehydrogenase, short-chain specific"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02105"
FT                   /db_xref="GOA:C9YIH6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH6"
FT                   /protein_id="CBE02105.1"
FT                   /translation="MLYNKEQELLRKAVRDFVSKELDTLPAEMDKTGVMPKELIKKLAD
FT                   AKFISSNIPEEYGGGGAGYVSYAIVMEEIARRCASTATFVTAGSSLASLPILYNGTEEQ
FT                   KQKYLKGIATGELIGAFGLTEPGAGSDAGGQQTTAELVGDHYILNGRKTFITNGPFCDV
FT                   AIVIAVTDRSKGLRGTSAFIVESKWDGFSTGAHEDKMGIRGTETSDLIFENVKVPKENL
FT                   LGKEGQGFKIAMGTLEVGRIGVAALALGIAQGALDEAVKYTKQRVQFGKPIAKFQNTQF
FT                   TIADMETKVCAARGLVYDAAQKRDAGMRVAQESAMAKYYASEIANEVAYKALQLHGGYG
FT                   FIKDYEIERMYRDARIVSIYEGTSEVQKMVISSNVLK"
FT   CDS             444788..445573
FT                   /transl_table=11
FT                   /gene="etfB1"
FT                   /locus_tag="CDR20291_0371"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02107"
FT                   /db_xref="GOA:C9YIH7"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH7"
FT                   /protein_id="CBE02107.1"
FT                   /translation="MKILVCVKQVPDTNEVRINKETGTLIRDGVPSILNPDDANALEEA
FT                   LKIKDEHDDVTITVITMGPPQADFMLRECLAMGADDAILLSDRAFGGADTWATSNTIAA
FT                   GISKVGDYDIIFAGRQAIDGDTAQVGPQIAEKLDIPQVTYVQDFKIEGKDIIVQRQLED
FT                   GYELIKVSTPVLLTAVKELNTPRYMSVDKIVKAYKHDVKVWTIDDLDVNKEEVGLKASP
FT                   TKVFRSFTPEPRGKGEILEGKADEIASKIIIGLKQKHII"
FT   CDS             445592..446629
FT                   /transl_table=11
FT                   /gene="etfA1"
FT                   /locus_tag="CDR20291_0372"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02109"
FT                   /db_xref="GOA:C9YIH8"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH8"
FT                   /protein_id="CBE02109.1"
FT                   /translation="MNDIKDLSSYKNVWIFAEQREGKIAPVVIELLGEGRKLAKEVDAE
FT                   LCAILLGKDVDGLAKELITFGADKVYVADDALLEKYTTDAYTKVIKDAIDEIKPEIMLF
FT                   GATHIGRDLAPRIASRVGTGLTADCTKLEIDPEDKKIKQTRPAFGGNIMATIICPNHRP
FT                   QMSTVRPGVMDKAEKDETRTGEVIALDYKITQDDIRTTVLETVKTKKDLVSLTDANVIV
FT                   SGGLGLGGPEGFEMLKKLADKLGGVVGSSRAAVDAGWIDHSHQVGQTGTTVKPNLYIAC
FT                   GISGAIQHLAGMQSSDFIIAINKNPAAPILEIADYGVVGDLHEIVPMLIEKLDSVDDLL
FT                   EAIKA"
FT   CDS             447112..448743
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0373"
FT                   /product="sigma-54-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02111"
FT                   /db_xref="GOA:C9YIH9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIH9"
FT                   /protein_id="CBE02111.1"
FT                   /translation="MDNNLIGLIEHVENPAILCKESGEIIYCNHLIDSIFSFLDIKKPR
FT                   NINELDSNFDKTEILTDSKKKIAFRELRMTAHIYNMKDNNNENNIVYLFEKSLISDKVI
FT                   EDIIEHIDEVVVVFNKDGVIEKMNTVSDEILPFKRTEVLGRNITDLVRQGLVEEPIILN
FT                   MLKVKKKIYRNIVYPDGKLIAYTAVPRWDSKGKLTGGVLTGRDISRVIKLESQIKYSDI
FT                   SEDTEYISQSKIMDNIKKVVKRAAASDSSIFINGESGVGKEIIARTIYKYSSRRDKPFI
FT                   AINCGAIPNELLESEFFGYEEGSFTGAKKKGKKGLFEEANGGTIFLDEIGELPMQMQKK
FT                   LLRVIQENTITRIGGSKPIKIDVRYISATNISHEDLRNNLKFRQDLYYRLSVIPVKIPP
FT                   LRERKEDIVPLVNYFLKLYNEKYNREVEVSPKVIELLEEYSWPGNIRELKNIIERFVVL
FT                   SAKNVIGEDEFNMLINLDMIDNETDDLSPIVVNGIMNLNDAYKIVDQIMISKAINKYGS
FT                   ITKAAEVIGIYPSTIHRKIKSGHIHV"
FT   CDS             complement(448878..449804)
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="CDR20291_0374"
FT                   /product="putative fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02113"
FT                   /db_xref="GOA:C9YII0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII0"
FT                   /protein_id="CBE02113.1"
FT                   /translation="MALITTKEMFKKAYEGGFAIGAFNISDLEQLQGVLKAAKAKNSYV
FT                   MIQASMSAVKYAGPHTLVEMVKAASDEIGVDVALHLDHGPNMDAIKTCIDAGFSSVMID
FT                   GSHFDFEENVRITKEAVEYAHSKGVVVEAELGVLAGTEDDVTSDVHKYTQPAEAVEFVE
FT                   RTGVDSLAIAIGTSHGAFKFKGEAKLRFDILEEIQSKLPGFPIVLHGASAVDQNAVATC
FT                   NEFGGNIAGAKGVPVDMLRKASSMAVCKINMDTDLRLAMTAAIRKFLAENPKEFDPRKY
FT                   IGAGRDAIQAVVESKIDDVLGSANSIN"
FT   CDS             450134..450463
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02114"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR015017"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII1"
FT                   /protein_id="CBE02114.1"
FT                   /translation="MPQIKIRGINENDICKISKKMINDLVEAVKCPRDYFEIECIKSVA
FT                   IRDGKIADVYPFVEVAWFDRGQEVQDIVARIITDSIRNNLDVESMDLAFTVFEKEKYYE
FT                   NGEHF"
FT   CDS             join(450463..450666,452497..453069)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0376"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02116"
FT                   /db_xref="GOA:C9YII2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII2"
FT                   /protein_id="CBE02116.1"
FT                   /translation="MAKKQRIDKILSNLGYGSRSEIKKYCKQGSVVVNGSEVSNPGTQV
FT                   DTENDEILFNGEEVIYREYIYLIMQNSVKQEPCDFSHGRFRMNKPDGYISATTDKYDPT
FT                   VLDLIDLSYLAFEPFPVGRLDKDTEGLLVLTNDGKLSHRVLSPKKHVPKTYYAKIDGVV
FT                   TEEDVEAFLEGVVLDDGYKTMPSQLNILKSDDESEIELTIHEGKFHQVKRMFESVGKKV
FT                   VYLKRLSMGNLKLDESLELGEYRELTDEEVKLIEER"
FT   CDS             451314..452432
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0377"
FT                   /product="transposase-like protein b"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02118"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII3"
FT                   /protein_id="CBE02118.1"
FT                   /translation="MIAVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIEVYK
FT                   NDKETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALKDLDNAYKKFFKEKAGFPKFKS
FT                   KKINRFSYKTNFTNGNIMYCGQHIKLPKLGMVKIRDKQVPKGRILNATISKEPSGRYYV
FT                   SLCCTDVDIEVFENTNNQIGLDLGIKEFCISSCGEFIENPKYLKKSLNKLAKLQRELSR
FT                   KTIGSLNRNKARLKVARLQEHIANQRNDFLQKLSTKLIKENDIICIEDLQVKNMIRNCK
FT                   LSRLISDVSWSEFIRQLEYKANWHGRQIVKVGKFFASSQICNKCGYKNEEVKDLSIREW
FT                   ICPSCNETHDRDINASINILKEGLRLITTQNK"
FT   CDS             453096..454457
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0378"
FT                   /product="putative tRNA (Uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02120"
FT                   /db_xref="GOA:C9YII4"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII4"
FT                   /protein_id="CBE02120.1"
FT                   /translation="MSVKKKDVIEFEVDKMEFGGTSLSQVGDRVIHMKGGISGQKVRAG
FT                   VKKVRSKKAEVKMIELLENSPLETEETCKHFRECGGCTLLSVPYEKQLEIKEKQVMDLF
FT                   LKQDLFGFQFLGIEGSPENKYYRNKMEYTFGDEVKNGPLTLGLHKKGKHIDIQTVEECM
FT                   LVDEDFSKILVSSVEFFNEKKLPYYRTMNHKGYLRHLVVRKGIHTNEIMVNIVTSSQED
FT                   FDMNEFKDMLLGIDLKAELVGVLHTINDGLADAVQCDELRVLYGRDYIQEEILGLKFKI
FT                   SPFSFFQTNTKGAEVLYSIARDFIGDYNDKVVFDLYSGTGSIGQVMAGAAKKVYGIEIV
FT                   EEAVVAANENAKLNGLTNCEFIAGDVAKVVKDLKDKPDLIIVDPPRPGIHKDAIRDICG
FT                   FGAKEIVYISCNPKSLVVDLVDFKGYGYEIKMVKCMDMFPNTPHCETVVKLIRE"
FT   CDS             454980..456014
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0379"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02121"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII5"
FT                   /protein_id="CBE02121.1"
FT                   /translation="MFKKKLIAVAMSITMISVGSFSYAHSGRTDSSGGHRDNKNKSGLG
FT                   SYHYHCGGYPAHLHNNGGCPYTGGGSSSGTTTSVNNEEKQKRSVGEKGYNQGYEDGYKG
FT                   NYSSSNYSGDYSDTYESKYSEGYEKGKAKLEEEEKVAKETGYNLGLTGAKSNNTYEKEV
FT                   LKNAYDTGYSTGYNEYKTKKIEEYKAKGIEDSNKDKEKMTFEENIDSEFIDAYNNAYDE
FT                   IQEQLKNDYTTQGFESAIKGERFDTSTIGNVKYANWFKEGYDNGKVKLPKAKESVYNQG
FT                   YNEEDFSIPYEMKSIETKLKGVYDEGLEKREEEKSRNATYGVGAGTAAVVAGVVYKNKK
FT                   RKKI"
FT   CDS             456101..456304
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02123"
FT                   /db_xref="InterPro:IPR025330"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII6"
FT                   /protein_id="CBE02123.1"
FT                   /translation="MGFNFRKSINLGGGLKLNLGKKSVGISAGVKGARVSVNSKGRKSA
FT                   TLSIPGTGISYTKTSTKKRKPK"
FT   CDS             456475..457635
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0381"
FT                   /product="cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02125"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII7"
FT                   /protein_id="CBE02125.1"
FT                   /translation="MKLSKTLLAIGMSVSLLIASCPTSNALSSINSIKGTNKYETAGLI
FT                   ADKQNYDIAILINSENGLSDGLSASGLSGAKNAPILLTKKDTIPSETLKRLEKVKEVYL
FT                   IGGKNSIGASVQKILSDKKISINRISGTDRIDTSHKVAKEIGRVSTVKKVILTNAFKGE
FT                   PDAMSVASIAVRDKSPIVLTDGNTTSFATDGLETYAIGGKVSMSDKLINETKATRIGGV
FT                   DRYDTNKQIINKFYNGSKEFYIASGTDLVYSLVGSTIAQKTPIVLVGNGSNKSILKNAS
FT                   KITAIGNIDDVIIKQCLNITNNVGDSNTGIVKDTNSNNTNKPSNEPSSNNPGLTDKSTV
FT                   YVTPNGKSYHLTKNCSTLKRSKTINKVTLKQAKSQGKIDPCNVCVK"
FT   CDS             complement(458166..459065)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0382"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02127"
FT                   /db_xref="GOA:C9YII8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII8"
FT                   /protein_id="CBE02127.1"
FT                   /translation="MVITLSKNEDKYKAIQSLFNEKKASLIQLCEIAKVNRSGYYKWLN
FT                   RDKSNLELENIKLATLITKIYEEKKGVFGSLRMTLQLNREYKLNVNHKRVYRLMRAVGL
FT                   RSICRKKKFSYVKCTQEVIAENVLNRKFSADKTSQKWLTDVTEFKLTDGTKAYLSAILD
FT                   LGDRSIVSYVIGKSNNNNLVFETFNKAIEVYPNAKPIFHSDRGYQYTSRVFKSKLLTQG
FT                   MIQSMSRVGHCIDNAPMEGFWGILKVEMYYLRKFDTYEQLVKAIDDYIYYYNNFRYQKR
FT                   LNSMSPLEFRKYLSTEIA"
FT   CDS             complement(459059..459730)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0383"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02129"
FT                   /db_xref="GOA:C9YII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C9YII9"
FT                   /protein_id="CBE02129.1"
FT                   /translation="MSKTKVSSEQKIEAIESYLKGENSVIKIMEELNIGKRTFREWMRN
FT                   YETFGNDGLIKQSHKSCYSKEFKLNAIESYLNGEGSYDTISKKYKMRSVHPLKAWVKEY
FT                   NLHKVIKETPKGGLFMETRKTTLDERAEIVKDCIEHGLNYNLIAKKYFVSYSQVRRWTL
FT                   KYKENGIDALEDRRGKSKKEDELTQLDEIKLELKIVKAEKHKLQLENEFLKKLKIIERG
FT                   W"
FT   CDS             460831..462204
FT                   /transl_table=11
FT                   /gene="rocR"
FT                   /locus_tag="CDR20291_0384"
FT                   /product="putative arginine utilization sigma-54 dependent
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02131"
FT                   /db_xref="GOA:C9YIJ0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ0"
FT                   /protein_id="CBE02131.1"
FT                   /translation="MNEILENIDEGVHFVNKDGKTIIYNNSVQKMEKMNRHDILANSFF
FT                   DIVNKMKINRSTLLEVLEKREVIKDNIQKYLDKNGKEITAINTTIPIDIKGEFVGALEI
FT                   SKNMTTIENLLNRNYKKNLVNKVSSRQKKGYEFDDILGESNLIKEAIEKSKKACKSDAS
FT                   VFIYGETGTGKELFSQSIHYGSNRRNYPFIAQNCAALPESLFEGILFGTSKGGFTGAID
FT                   RPGLFEQANKGTLLLDEINSMPIMLQAKLLRVLQEGYVRRVGGTKDIPIDVRIIATTNE
FT                   SPKVILNEHKMRKDLYYRLNIIHIKIPPLRDRKEDILLLCKKFISKYNKKLNKKVVGIS
FT                   DEAIKILKNYDWQGNIRELENIIYCTMSMMEDEVQIETSMINLNDYYNLKENKESNNYS
FT                   LNDLEGKTLSKIISEIEEKYIYESLEKASYNITKAASILGMNRQNLQYKIKKYNIKIL"
FT   CDS             462460..463527
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0385"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02133"
FT                   /db_xref="GOA:C9YIJ1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ1"
FT                   /protein_id="CBE02133.1"
FT                   /translation="MRKVRVGIWGFGAMGIGMANMILKKEGIEIVSVCSRSTSGKSMYD
FT                   VLGIERGERPEVIINKNYEEVFREKSVDVVLLATDSFTKKAFDKIIFLLNRKINVISTA
FT                   EQMAYPQADDADLAKKMDEVAKENGVSILGTGINPGFVLDLLVLALSGTCEEVTSIKAK
FT                   RVNDLSPFGKSVMEEQGVGVTREEFIKGVEDKTIAGHVGFVESINMIADGLGWKLDKIE
FT                   QTKEPIMTTVDRKSKYGEALAGNVAGCRQCGYGYVNGDVLIEMEHPQQIIPEVEGIKTG
FT                   DYVSIKGIPNIDLQINPEIPGGVGTYAMIVNSIPLIINARPGLKTMLDIPVPRAIMGDI
FT                   RNQIEVELEEESKAN"
FT   CDS             463624..463932
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02134"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ2"
FT                   /protein_id="CBE02134.1"
FT                   /translation="MDAKINDWVIIHNIVLTPEERAPQVPEDTKKVSLEMWVKGFIQSD
FT                   ASIGDLVEVKTITGRLVKGNLLKVNPYYTHDYGKCIPELLQIGIQAKEILFGGVYNE"
FT   CDS             463925..465355
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0387"
FT                   /product="putative pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02136"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ3"
FT                   /protein_id="CBE02136.1"
FT                   /translation="MNNSTSIKDMSYQAVMGRNNEIMKNAIGLDYSSFEQEGIGFDYEK
FT                   MMSETGYTLQDIEAIQSQYAVGNTPLIELKNLTKLARKCAKEGKGAKIFVKDEAMNASG
FT                   SFKARRAATAVYHAKQMGYKGVIAATSGNYGAAVASQAAMQGLKCIIVQECYDSNGVGQ
FT                   PEIIEKARKCEAYGAEVVQLTVGPELFYTFLVLLEETGYFNASLYSPFGIAGVETLGYE
FT                   LAIQFREKYKKDPDIVVCTNAGGGNLTGTARGLIKAGSINTKVVGASVDLKGLHMASDN
FT                   QFNKKSFTTGHTGFGIPYCTWPDRSDVPRSAARPLRYMDRYVLVKQGEVFYTTELLAQL
FT                   EGIERGPAGNTSLAAAFSLAQELDEDKVIVVQETEYTGAGKHICPQLTFARENGIDIKF
FT                   GNPREEIAGVNLILPERPELLKCVDIDMNKIRKSFIKNCISNNHIDNIDKLSNRDIEFL
FT                   MEEVKSSRDFVVDVLNNL"
FT   CDS             465433..465807
FT                   /transl_table=11
FT                   /gene="oraS"
FT                   /locus_tag="CDR20291_0388"
FT                   /product="D-ornithine aminomutase S component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02138"
FT                   /db_xref="GOA:C9YIJ4"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ4"
FT                   /protein_id="CBE02138.1"
FT                   /translation="MKKREDDFEVRRKHLQELSDDELKERFWNLATQIVEPMIELGKKN
FT                   TTPSIERSVLLRMGFSSLEVKPILEGVMERGLIGKGAGHVVYKLAKSKNITVREAGLLL
FT                   VKGEYWDEVTCLFREGVESC"
FT   CDS             465801..468005
FT                   /transl_table=11
FT                   /gene="oraE"
FT                   /locus_tag="CDR20291_0389"
FT                   /product="D-ornithine aminomutase E component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02140"
FT                   /db_xref="GOA:C9YIJ5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR015130"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ5"
FT                   /protein_id="CBE02140.1"
FT                   /translation="MLKENKKLDIDYILKDLDKYKPKRRGWVWREHLENLEMGPFKYKD
FT                   CTKPLKKSVGLPSSKYFNNIDPQPSPVITTEIASGRFEDDIRRMRMAAHHGADHLMVIR
FT                   TAGQSHFDGLIEGTPQGIGGVPITRKQVRAQRKALDFIEEEVGRPINYHSYVSGVAGPE
FT                   VAVMFAEEGVNGAHQDPQYNVLYRNINMVRSFVDACEAKKIMAFANIAQIDGAHNANAT
FT                   AREAWKVMPELMVQHALNSIFSEKIGIDKSNICLSTVPPTAPPAPCLRIDLPYAVALRE
FT                   LFSDYKMRAQMNTKYMESSTREATVTHVLNLLTSVLTRADIQSTITPDEGRNVPWHIYN
FT                   IEACDTAKQALVGMDGLMDMIELKDVGELRDKARELKERAVLYMEEISEVGGYFESVEQ
FT                   GFFVDSGNYPERNGDGISRKIKGGVGEGTVYEREEDYLAPVTAHFGYNNVAQYDENAID
FT                   NPSMLIDGCTFENPDKIIYIDELDDFDNVENRLKESYEYRNGTKIKPEMEWCADGIVMI
FT                   TMMLPTDKRTAEFAALEFVKKMNLQEIEVISREVMHESEGTRIEVKGRVPFDIDLNNLV
FT                   IPEEPKVLTDEEIRADIEEKPMKIVSATVGEDEHSVGLREIIDIKHGGIEKYGIECHYL
FT                   GTSVPVEKLVDAAIELNADAILASTIISHDDIHYKNMKKLHDYCVEKGIRDKVMIACGG
FT                   TQVTPEIAVEQGIDAGFGRNSKGIHVATFLVEKRREMSNK"
FT   CDS             468005..469414
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0390"
FT                   /product="putative component of D-ornithine aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02141"
FT                   /db_xref="InterPro:IPR006230"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ6"
FT                   /protein_id="CBE02141.1"
FT                   /translation="MENSKVSLKIDVLVAEIGSTTTVVNAFHDINTNNPIFLGQGQAPT
FT                   TVFEGGDVRNGLSGAIKDLANKLSVDDIEYNDMFATSSAAGGLKMTVHGLVYDMTVKAA
FT                   KEAALGAGAVIRQITSGRIKRTDLNKIKEINPNIILIAGGVDYGERDTAIYNAEMIASM
FT                   NLGIPVIYAGNVENQEEIRLIFEDTNYKLYITENVYPKIDLLNIEPTRRIIQSVFEEHI
FT                   TTAPGMKYIKEMVNENITPTPGAVMEASKLLYKNIGDLLTLDVGGATTDVHSVTDGSDY
FT                   INKILVNPEPTAKRSVEGDLGVYVNMKNIVEVIGKENLQSELYIDIDAVIENYPPIPKS
FT                   KEEILFVERLTKEAVVKAMLRHSGKIRNIYGTTGKVKIAEGKDLTEVRYIVGTGGALTR
FT                   LPSRIEILDNMLKYNKNNELLFPKEKTKILIDNDYIMASMGVLSKKYEEASLKLLLKSL
FT                   NFEEERLCILG"
FT   CDS             469399..470463
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0391"
FT                   /product="putative amino acid racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02143"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ7"
FT                   /protein_id="CBE02143.1"
FT                   /translation="MYPRLEIDIEKLKHNAKLISQMCHERSIKISFVTKSFCAQKEIVE
FT                   EICSEGIDHIADSRIQNLKKLQDINLPKILIRIPMLSELEEVINYCDISFNSELETIKK
FT                   LNELCESKNIIHKIVLMFDLGDLREGYFYEEDFFNNVREIVRLKNIEIIGIATNLTCYG
FT                   AIIPSRENIGRLVSIAKRMEEKFGINLEIVSGGNSSSIHLLINNNMPEGITNLRIGESI
FT                   LLGRETAYGENINGTYQDAFKLICQVVECKEKPSVPIGEIGVDAFRNKPVYEDKGILKR
FT                   AIIAIGKQDINIDSLIPIDTDIKILGASSDHMILDVSNTKYDYKLGDNLEFLLTYGGIM
FT                   SSSTSKYVSKKIIV"
FT   CDS             470493..471914
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0392"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02145"
FT                   /db_xref="GOA:C9YIJ8"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ8"
FT                   /protein_id="CBE02145.1"
FT                   /translation="MKERECRKASLFDAMIPITCLILFLSLGVLVYGSSPHVPLIGAAA
FT                   VAGLVAVYRLGFKWKELELSMFNSIKMAMQAILIIIIIGVLIGTWIVSGVVPCMIYWGL
FT                   KILSPNIFLVASTLVCAIVSLATGSSWSTMGTVGVALLGIGQSLGMPIGLIVGSIISGA
FT                   YFGDKLSPLSETTNLAPAMAGTDLFTHIKYMLYSTIPSLLICLVIYGVIGMKYSGQALD
FT                   IKQIELIRSTLDSTFNTLSPVLLLAPAIVIGLVVFKVPAIPGLIVGAVLGVLFAVVFQG
FT                   ESMNTILDAAQNGYVSSTQIQEVDALLSKGGIMNMMSTVSLTICALSLGGILEKTGMLE
FT                   VVASSLLRLAKGVFGTVLCTMVTCTITNIIAGEQYLSIVIPGRMYNKEYKKRGIHPKML
FT                   SRALEDSGTLTSPLVPWNTCGAYITATLGVSALTYGPYALLNIINPIVSLVLIACKFKI
FT                   ARIEDEPETCLNFDV"
FT   CDS             472343..472807
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02146"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIJ9"
FT                   /protein_id="CBE02146.1"
FT                   /translation="MTRISNITIAEQSEYCFLAIRKTIDFMVEFSEFSKQSFEKISKYL
FT                   EERGILSSGAPIVCFHNMDLAKLDVEVGFPVATYIDGKNEILQRIVPAQKIITAIDLGP
FT                   YELQDPTLEDLFSWANSNGYKLHGDIYYQYLNDINRPASEYLTKMMLPII"
FT   CDS             473105..473467
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02148"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK0"
FT                   /protein_id="CBE02148.1"
FT                   /translation="MKIYDILTRFYIQDIEKAIPFYENLLKEKCSLRFSYKEVGLELAQ
FT                   IGNVLLLSGSDDALKPFIETKSTFMVDSVDEWRSYLLDNGAVVVRDKKKVPTGYNMTLR
FT                   HPDGTIIEYVQHTKQD"
FT   CDS             474038..474922
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0395"
FT                   /product="AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02150"
FT                   /db_xref="GOA:C9YIK1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK1"
FT                   /protein_id="CBE02150.1"
FT                   /translation="MDKRREAAMSYKVINVITAIDYIEEHLSEKLDLDIIANAVHYSKY
FT                   HLHRTFTTSVGLTMHDYIKRRKLTEAAKLLVFSKKPIIEIALIAGYESQQAFTSIFKAM
FT                   YKKSPNKYRKEQEFYPLQLRFVLKKDNLFSKNVLELEKEIKLASMSDIPLWMNLVRLVI
FT                   DGFPNLQEEEYIYQLEQYILEERALILKLNNVAIANMVFNRETRSIDFFGIHPQYRNSD
FT                   IAQVFLKKVIEDFLIDTDISITTFREGDKADTGHRDMIKKLGFAEAELLVEFGYPTQKF
FT                   ILPCVEERDNRQN"
FT   CDS             475180..477294
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02152"
FT                   /db_xref="GOA:C9YIK2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK2"
FT                   /protein_id="CBE02152.1"
FT                   /translation="MSENKQVVNCDIIASNSKHNMCEHDVELLTFFPDEIAHLIEINNK
FT                   LDNAFKKAENLVDKLDKDYMDAKMYMVKNRGEIDPHEMFQNEQGLKQIDNYGAFMVKVR
FT                   DKINKIKDSPYFARIDFRLKDMDDESKYYIGRFAFDYEDELIILDWRSPIASMFYDYEI
FT                   GKAGYDAPIGWVDGEITRKRQFKIKNGKLEYALESSINIQDDILQKELSHTSDEKMKSI
FT                   ISTIQKEQNQIIRNDKADTLIIQGVAGSGKTSIALHRIAFLLYRFKDKISANNVIILSP
FT                   NKVFGDYISNVLPELGEEPLCELSFENIAEVQLDRVINFESEKDPLEINDAKWSERVRF
FT                   KSTLDFVKLIDDYIKQMPNKIFIPKDYTFGSFTAKSDWIQSRFEAYNRYPVKKRLEKVA
FT                   EDIHYKFESDNIMEEDLPKVKSILKSLNGMLTIKNTLTLYKDFFKQMNISNMFVMAEKK
FT                   TLEWSDVYPFIYIHAAYEGIQEDKIIRHIVIDEMQDYTPIQYAVINLLFKCKKTILGDF
FT                   GQLVNPNHTHTLDDMKQLYNDGELVMLNKSYRSTFEIINFAKKIQDISSLEPIERHGEE
FT                   PALLKCNNEQDEINKIKIEIEEFKKSDNATLGIILKTDNDAKAVYDALREEYSVHLISS
FT                   ESSSFTKGVSITSIKMSKGLEFDEVIVPSVNNKTYYSDYDRSLLYIACTRAMHKLKLTY
FT                   VGTLTQLISM"
FT   CDS             complement(477556..479799)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0397"
FT                   /product="putative antibiotic resistance ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02154"
FT                   /db_xref="GOA:C9YIK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK3"
FT                   /protein_id="CBE02154.1"
FT                   /translation="MSNIIIKGLTQNNLKNISFKIPKNKIVVFTGVSGSGKSSIVFDTI
FT                   AAESQRQMNETYSSFIRNRLPKYRKPQVELIDNLTASVIVDQTPLGGNARSTVGTISDL
FT                   YSSLRLLFSRIGEPYIGTTSYFSFNDPNGMCKNCSGIGRVKVINIESIINPENSWNTGC
FT                   INDSLFKPNSWYWKQYAESGLFDLDKPIKDYSFEEYNLLLYGSKNKDGKQENPKIEGIF
FT                   NKYNQTYLNRDISNMSKHTKEKSERLITDKECPVCHGKRLNKETLNCNILGYSIADMCN
FT                   MELTDLYDLLLQIKDKRTETVIKTLTDGLKRMIDIGLPYLHLNRESSSLSGGEAQRLKL
FT                   VRYMGSSLTGMTYIFDEPSAGMHPRDVHRMNQLLKKLRDRGNTVLVVEHDKDVISIADE
FT                   VIDIGPSAGTQGGHVVFQGSYDKLLLANTLTSNAMNLSLPIKTDSRHPKGTLPIRDACI
FT                   NNLKHIDVDLPVGIMTVVTGVAGSGKSTLISRVFAQKYEKDVIKIDQSPVTATNRSMPA
FT                   TFLGFFDEIRKVFAKENNVEEGLFSFNSKGACPVCDGKGVLVTELVFMDPIINTCEACK
FT                   GTRYSEEVLSKLYKGKCIVDVLSMTVDESLEFFTEKKLCKILQTMKDVGLPYMTLGQPL
FT                   STLSGGERQRIKLAKNLNKKGTIYILDEPTTGLHGSDIEKLMLIFEHIVDKGNTVIIIE
FT                   HNLDVLKQADWVIDIGPDGGKNGGQVVFEGTPLEMFERGCTITSDFLRKSINI"
FT   CDS             480131..480847
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0398"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02156"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK4"
FT                   /protein_id="CBE02156.1"
FT                   /translation="MILIVILSIFIIASINIIILGKENIRDIVIPLTLFIVSDFLFLCG
FT                   NIICRGGVMLLFIGLFAIPLMLIAFIWICVHMIKLYYKKDLNKRKMIGCIFSIFISIGT
FT                   IFIPSPSESFRFKLYEKDYSVVAKAILKVYDEKKLSSESVFYIQSDKNELEKIFSKEVI
FT                   KKMKKLNRNLDVVKISGNRNLVYFFFGAELQSIDGIVIFKDLKHVKPKLDFINRSIQAP
FT                   RLEYITNNVYYFKGEL"
FT   CDS             480875..481813
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0399"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02158"
FT                   /db_xref="GOA:C9YIK5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK5"
FT                   /protein_id="CBE02158.1"
FT                   /translation="MKRKNNFIWIVILLVVVAMGVYYVGRKHNNTKQKHDKNHINSELN
FT                   KSKVENNDKNKKEKINMVDYSDCFEGISGGAIFYNTKNKEYNIYNKELIETRRSPCSTF
FT                   KIVSTLIGLEKGVINSKESVMGYDGTEYPNKNWNKNLSLEEAFKESCVWYYKKLIDKVD
FT                   AKSVQNILDDLKYGNCDISEWEGDLKNGKGHLNGFWLESSLQISPKEQVQTMAKIFEGD
FT                   TNFKKEHINILRDIMKIDVNDKNINVYGKTGTGFDEKNKRVDAWFVGMLEREGDTYYFA
FT                   IKSDDSNKEITGPKVKEIAINIIKKYYSVRE"
FT   CDS             482157..482840
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0400"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02160"
FT                   /db_xref="GOA:C9YIK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK6"
FT                   /protein_id="CBE02160.1"
FT                   /translation="MEILKCENLTKIYGSNQTRVTALNNVNLSVQKGDFVSIVGASGSG
FT                   KSTLLHLLGGVDRPTSGKIYVEDTEISSLKEEALAVFRRRKVGLIYQFYNLIPTLDVRK
FT                   NILLPMLLDKRKVDEDRFSEIVSILGLSDRLNHLPSQLSGGQQQRVSIARSLIYRPAIL
FT                   LADEPTGNLDRKNSEEIVDLLNLSNKRFNQTILLITHDEKIALEANRIVTMEDGVIVSE
FT                   KVVKK"
FT   CDS             482837..485497
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0401"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02161"
FT                   /db_xref="GOA:C9YIK7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK7"
FT                   /protein_id="CBE02161.1"
FT                   /translation="MNILQEYTLDFVRRNKRSSIAIMLAILLTTTMMSSLCGLLYTMWT
FT                   DFIRLSIEKEGNWHGELFDYTYGSDLPLIENFSSVDDVMVKGQWYVGKINDEKRDYIIY
FT                   RNATSEYWNSMPEKDTIIEGRRPNNANEIALSKQYFENNPSVKIGDKITLPIGDRILNG
FT                   KPLEPIAQKSKGESFKKISETTLTIVGKVDVSTSSVIPAYTALGYLDRTSIKPNDSITV
FT                   YLRFKNIRDTYKELPKLAKSLGWKTNEYGKYNLKYNSNYLLKMLVFSPEQKASMSSISK
FT                   FSTPIMYLTIAIFTVAVFVMVIYNAFSLSANARLTQLGILSSVGASPKQIKMSVVFEGF
FT                   LLTIIPLPIGLFLGWLLCNRLIVYINSVNYHTDVPEVVFTYGIPAFLPAVLLTIVTVWI
FT                   SALIPARKVSKISPIEAIRQGDSVKIKKSHKYSLGKIFGIEGELASNALRARKKSYRTA
FT                   TISLTLSFLLLTCFLHIIANQEGAKAVYGSDNYKDQRDIAVYLENSEPVESAFIEKLDN
FT                   TEGVKSSLYYQKMSASTWLTEKDASKELAKNGGFKSIVSSKKYSPIERDGKFRIISNII
FT                   GLDDKSFTEYCRQISVDPKLFYDTKNPTSIVYNKEEDINRSTRRNKVYIDYLNLSIGDN
FT                   IKLNEKVYDEDKGDYTYNMKVGAITSTLPKTVDTSSKYTLMQIVPMSMVQEISKNYDEV
FT                   SRLRSNRLIGVFKVNNREDIPRVREKLESIYNKDYGSGDYSIEDVLESEKQKASGIKTM
FT                   NLIVGFITGLLAMIGLSNVLATVSGNTRSRRQEFAMLRSVGLSPEGIKKMLVLEGLFLG
FT                   ITPLLLSIPVQIGIVYAFLRINEIYFIEYLPFAPISTIIGFTILILFIVIASYMTGYKQ
FT                   LKNENIVESIKNETI"
FT   CDS             complement(485678..486859)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0402"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02163"
FT                   /db_xref="GOA:C9YIK8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK8"
FT                   /protein_id="CBE02163.1"
FT                   /translation="MKTPRNINSTVVFIIFCLIITFLLSVILTTITSFNEYNVLSKALG
FT                   ASYEYNPKSTESILKSLKNSSDKDFKTGNEILSKHGYSKSTFWSKNFFYFLVISFGIIS
FT                   TMATVVYIIKHRTNKQKLSRINNLTQYLEEVNLGKESVLLRCEDEFSHLEDEIYKTVGE
FT                   LRCSKEFALKERQTLSDNLADIAHQLKTPITSMSLMAQLLSENCPDEEIDYINRLTNQI
FT                   SRLERLVSSLLTLSKLDASTLIFESKLIDVHSLLTYAIEPIEGSLREKHQTFTIEASPS
FT                   VEFEIDINWTLEALLNILKNCSEHIEDGGYIVAYYSQNPLYVEIIIEDNGKGFAQEELP
FT                   YIFNRFYRGKNASKDSIGIGLALSKSIIERQNGTLHAENCHNGGARFIIKFYT"
FT   CDS             complement(486859..487521)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0403"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02165"
FT                   /db_xref="GOA:C9YIK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIK9"
FT                   /protein_id="CBE02165.1"
FT                   /translation="MAKILLLEDDDTITFGIKTSLEKKNHTVCCYNTIAEAKKNFDKTI
FT                   DLILLDLNLPDGIGYEFCQYVKSIEDTPVIFLTVRDDEKDIIRGLDMGADDYVVKPFLL
FT                   SVLQSRINAVLRRTHSNTNNTITCGNISLNKVEVKAYLDNVEVLLTAGEYKLLLSLMEN
FT                   KNRAMTRTKLLEMLWDVDGNFVNDNTLTVTIKRLREKLKNPPCIKTLRGIGYRMEDS"
FT   CDS             complement(487666..488199)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0404"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02167"
FT                   /db_xref="GOA:C9YIL0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL0"
FT                   /protein_id="CBE02167.1"
FT                   /translation="MNELAKEVEYTKRTIYKYFSCKEDLFFAVVLRGYKRLWDNVKIES
FT                   AKGKTGFEKIKLSYFAFHKFYSVEPSLLCLMGMIGIVNSEKSDTDMLFKEKFFSFNKFM
FT                   FDEIQGMFEIGKNDRSIRHDIEIPTLMYSSIFTLTGFFNLLSVTGKSYLNNFNIDEEKF
FT                   IETTLALLIDSIKA"
FT   CDS             complement(488513..489445)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0405"
FT                   /product="transposase-like protein b"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02169"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL1"
FT                   /protein_id="CBE02169.1"
FT                   /translation="MVVVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIEVYK
FT                   NDKETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALKDLENAYEKFFKEKAGFPKFKS
FT                   KKINRFSYKTNFTNGNIMYCGQHIKLPKLGMVKIRDKQVPQGRILNATISKEPSGRYYV
FT                   SLCCTDVDIEVFENTNNQTGLDLGIKEFCISSCGEFIENPKYLKKSLNKLAKLQRELSR
FT                   KTIGSLNRNKARLKVARLQEHIANQRNDFLQKLSTKLIKENDIICIEDLQVKNMIKNHK
FT                   LSRLISDVSWSEFIRQLEYKANWYGRQIV"
FT   CDS             490459..491064
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0406"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02170"
FT                   /db_xref="GOA:C9YIL2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL2"
FT                   /protein_id="CBE02170.1"
FT                   /translation="MKIKENVLMLDSTRGSNCFIVFDKEIILIDTGLPFMGKNIIKELK
FT                   TLGIKLTDIKHILLTHHDVDHISNIKLLKEKTGAKVWAHVEDIPFIIGEKDRPGFKKFI
FT                   GKAISRRLIKDVEPYGENMKIGNIKIIHTPGHTPGHVCMIFEDVLFAGDLVKNKNGNIV
FT                   PYPNPWNWDYKKMMKSIRELDNLKYEWICMSHGTPCIK"
FT   CDS             491568..492317
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0407"
FT                   /product="RpiR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02172"
FT                   /db_xref="GOA:C9YIL3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL3"
FT                   /protein_id="CBE02172.1"
FT                   /translation="MRLESLVNQSYNSLNENDKIIIKQILICQREYRNFSCEKIANECN
FT                   VSRATLLRLCRKIGLDSFSDLKYLLKNNQLEFVNNDNNFHDVCENYRLLMNELQKISFQ
FT                   DICKIIYDAETIYIYGTGNEQKSLAQEIKRIFLSVGKCVIDLFDIGEIEFMRESFQKSD
FT                   LFIIISLSGETKSGIEIAKFINNHIHTISLTRLDNNTIATLCEYNLYVETQKLDTLQAI
FT                   SYEVVGAFYALLDLLHMNYIEYRRRKE"
FT   CDS             492314..493078
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0408"
FT                   /product="RpiR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02174"
FT                   /db_xref="GOA:C9YIL4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL4"
FT                   /protein_id="CBE02174.1"
FT                   /translation="MKIEGLFNKYYNSFTANDKYICECILNHKEDCIKLSIDEFADKYH
FT                   ISTSALSRFAQKLQLPGYSELRVIIRLNETEVEYKNQSKHQLMDCYNKVIDDIEKKDCS
FT                   IMFERMKKANRIIVFGEGYSQERVVKEMKRIFLPTGKIIYDVYGYDMIQALNHFIKTDD
FT                   MIFFISLNGDTSTIIDFAKEMRMKGTYMVSITKMISNPLARLCDENLYIQSISISVDKQ
FT                   LDYDVTTPYFILIELLYIKYKMYLESEHIPRK"
FT   CDS             493177..493998
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0409"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02175"
FT                   /db_xref="GOA:C9YIL5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL5"
FT                   /protein_id="CBE02175.1"
FT                   /translation="MKLYKLLILDIDGTLRDEVYGIPESAKHAIRLCQKNHCSVVICTG
FT                   RSIGTIQDDVLSLGVDGYIAGGGNYIQYHGELLYNQSFNQRLIKEVVCLLKKREVAFSI
FT                   ESQEKVFMNQKAKEIFETMNQLKGTNSCINKQHIQEKITYENNIEEYKSQDVHKICLWS
FT                   NEKVFDEVKDILQDKMELAQRDISSQYYEIIQKDFHKGKAIKRLQERLGVTQKETICFG
FT                   DGQNDIVMFQASDVTIAMKNSHQQLKDIATSICEDIFDNGIYKELKRRNII"
FT   CDS             494012..495676
FT                   /transl_table=11
FT                   /gene="malL"
FT                   /locus_tag="CDR20291_0410"
FT                   /product="oligo-1,6-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02177"
FT                   /db_xref="GOA:C9YIL6"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL6"
FT                   /protein_id="CBE02177.1"
FT                   /translation="MEKKWWQKEIVYQIYPRSFQDSNNDGIGDLQGIISRLDYLKDLGI
FT                   TSLWLCPIFKSPMDDNGYDISDYLDIASEFGSMEDLKELIKESKDRGIKIILDLVLNHT
FT                   SDEHPWFQEALKNPESPYHDYYIFKKGNDLPNNWRSVFGGSVWEKVENRDEYYFHSFGK
FT                   KQPDLNWENPILRSELYQMINTWSQMGVAGFRVDAITFIKKNLSFQSLESDGVDGLVKC
FT                   TKTVRNQPGIEKMLYELKENTFKKYDCMTVAEAAGISYDQLGDFIGEDGFFSMVFDFKH
FT                   ADLDVASGSEWFKRISWTIPDLRKCILDSQMYVQEHGWAANFIENHDQPRATTKYLLQY
FT                   ERNDDAVKMLGAMYFFLRGTPFIYQGQELGMTNFKRDTINDFNDLSSIDQYYRSIDEGY
FT                   SEEEALEFVNLRSRDNARTPFPWADKENAGFSDATPWLKVIENYKDINAQSQINNSESI
FT                   LEFYKKMIKLRQDSKYSDCLIYGSIEPIDIESDNVIAYRRQLDLVVIDCYYNFSDKLVE
FT                   IKTEEKYDIVFQNLDDINLLNKTVSLKPFQAVLLKVR"
FT   CDS             495681..497555
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0411"
FT                   /product="PTS system, IIabc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02179"
FT                   /db_xref="GOA:C9YIL7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL7"
FT                   /protein_id="CBE02179.1"
FT                   /translation="MNKYNKIANELIEIIGENNIISITHCATRLRVMVKDREIINDKKV
FT                   EKVNEVKGVFFTSGQYQIILGTGIVNKVYAEVEKMGLKTLSKKEQDELVKNNETGFKKV
FT                   MRTLADIFVPIIPVIAATGLFLGLKGCLFNDNVLGLFGMSSANIPLYIQTLVSVLTETA
FT                   FAFLPAIIVWSAFKVFGGTPVIGLVIGLMLVSPILPNAYSVADPSNEVEAIMAFGFIPI
FT                   VGCQGSVLTAIVTAFIGANLEKWFRKHMPNVLDLIFTPFFVMLITMLVILLGVGPIMHT
FT                   IELKMVDIISLLIGLPLGIGGFIIGFTYPLAVITGLHHTYVMIETSLLANTGFNALITL
FT                   CAMYGFANIGTCLAFMKKSKNNQVKQTAVGAMLSQLFGISEPVLFGIQLRYNLKPLIIM
FT                   CASSGLGAAILSILHIQSNSYGLAVLPSYLMYIYDGYNLITYLLVSIFVVAFCFIVTCL
FT                   FGVPKEAINEDEDEELVFNENNENFVSPAKGKIVALENVPDETFSKKMLGDGFAIDIID
FT                   GKIVSPISGKLETVFSSGHAFGIKGTNGEVLIHVGIDTVALNGDGFDIAVKQGDMVKQG
FT                   DVLVNVDLKRIHELGKSTLTMVLFPDGKKVNILDINKDVKIGQRICVE"
FT   CDS             complement(497910..499709)
FT                   /transl_table=11
FT                   /gene="blaR"
FT                   /locus_tag="CDR20291_0412"
FT                   /product="putative beta-lactamase-inducing
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02181"
FT                   /db_xref="GOA:C9YIL8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL8"
FT                   /protein_id="CBE02181.1"
FT                   /translation="MYAPFFIRFLLSTLTLSILIVIILLAKKVFKKHISAKYQYNIGFI
FT                   LLIMLIIPFVPLKYINLGNVFNYLYTFNQLGSSTNRTSIIKNSPNSIINNSNALNDFSV
FT                   SLNQVNFDSLNILLLISWIIGILIMIAITIHCNIKIKNMKKSIQILRDEEIVFIFEKCK
FT                   KDIGINKDFILCKSPIINTPITFGYFKPHIILPDKSISKLSLKDIKYILLHELQHFKNK
FT                   DILINYIMCFLQILYWFNPLVWYAFKEMRIDREIACDISVLKKLDKDSHIEYGQTLINF
FT                   VDNISRPSNLTLTSDIGGSKKQIKKRLLKIMDFHNESNTLKFKSILIFTLIALIVFGNI
FT                   PKLSIMADINEKYRPTNEQTVYEDLSQYFKGFDGSFVMYDLKSKQYHIYNKEKSKTRIS
FT                   PNSTYKIYSALLGLENGIITRNNSHIPWDGKHHSNSSWNEDQDLFSAMENSVNWYFQTL
FT                   DKKTGLKNIQTYLKQIGYGNYDVSGGISNFWLESSLKISPIEQVELLESFYTNKFKFED
FT                   KNIETVKDSLLISKKDGVSLFGKTGTANINGKDVNGWFIGYVEKNENTYFFATNIQSKD
FT                   YSNGSSASKITLSILNDKKIYNP"
FT   CDS             complement(499712..500098)
FT                   /transl_table=11
FT                   /gene="blaI"
FT                   /locus_tag="CDR20291_0413"
FT                   /product="penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02182"
FT                   /db_xref="GOA:C9YIL9"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIL9"
FT                   /protein_id="CBE02182.1"
FT                   /translation="MKKLPHISEAEYQVMKIIWKYAPISTTEVIEKLVETSTWSPKTIQ
FT                   TMLLRLVKKGALTYEKNSRVFVYTPLVKEEEYVATESSSFLNRFYNGTLNSMVLNFLEN
FT                   DKLSEDDIEELREILNKRTTKGDK"
FT   CDS             500331..501008
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0414"
FT                   /product="putative iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02184"
FT                   /db_xref="GOA:C9YIM0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM0"
FT                   /protein_id="CBE02184.1"
FT                   /translation="MIITVINGSPRKNGATSKVLTYLYKDIERLIPDVKINYFDLSEVN
FT                   PSYCIGCLNCYKMGKCINQNDKVEYIHDIITKSDGVIFGSPTYGSSVTGLFKVFTDRAH
FT                   MMLERLLYRKPCIAVTTYENARGSKAISFIKSMVLDSGGYVCGSLSIKTGFNQNPITEK
FT                   VESKIQKVSKKFIYCIEEKKNPPVLSQIYNFIAINAVLKPMAFKDIEQYKGIIDRWEEQ
FT                   GII"
FT   CDS             501020..501445
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0415"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02186"
FT                   /db_xref="GOA:C9YIM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM1"
FT                   /protein_id="CBE02186.1"
FT                   /translation="MKDFEKLYEATTKLVSTSLKVKDDLKKMFKQNGYDITTDHYALLR
FT                   FLWEQDGISQIDLCEKSCKDKSNTTRILDVMKNKGLIVRKVDVKDRRKFQIFLTDLGRE
FT                   LEEPLNEIASIYATETFKSISDEELPLFTDILDRIGK"
FT   CDS             501513..502292
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0416"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02187"
FT                   /db_xref="GOA:C9YIM2"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM2"
FT                   /protein_id="CBE02187.1"
FT                   /translation="MNSKIYYFSGTGNSLVVSKILKETLNGSKEVIPLAIHRKENNIDI
FT                   NEDILVIVFPVYFADVPDIIKSFVEKLNFNINTHIYAIATCNGVAGHSLFTIDKLLKKR
FT                   GKKLSAGFLINMPGNALITPSDVEEERLKNQTNRVAEIAKCINNLEIGNIEGKNNLKSH
FT                   IDSVVLRLVGKNMQIATTKFFAENKCNGCGTCKRVCPVENISIVDKKPKWGNECERCLA
FT                   CFHWCPKEAINVKKSFLTNRKKYHHPDITVKDIFLDK"
FT   CDS             complement(502542..503285)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02189"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM3"
FT                   /protein_id="CBE02189.1"
FT                   /translation="MSCFICYYTFKYATIFSKLCALKLAFYSNLKLKTKETRYMKINIK
FT                   SKLSEFIKQNNLFDDNRIISYLPNITIETDKIKTIMINEVVPTNTNDDFYSVDKDADYL
FT                   KTTIPLFDSAGIEVSNINDILDMGIYITNAVKLPKSEYTITRDTIKLHMPILEEEIKLF
FT                   KNLEVVMLMGDVAKKSFNMITKKHIKKNVIPSISTYKLRNNELYYDNLRVFPSYIMTGG
FT                   NILIEKSKFEMASEDIKKMFEIING"
FT   CDS             complement(503311..503568)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02191"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM4"
FT                   /protein_id="CBE02191.1"
FT                   /translation="MILNRTELFRGYSLNRFNEICNILSVNKIKYKYKVKNNAYSKKPF
FT                   SNEITLGNLGQKEDFSYEYLIYVHKDDYEQAESLINSKLR"
FT   CDS             503894..504406
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02193"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM5"
FT                   /protein_id="CBE02193.1"
FT                   /translation="MKKISQEKISTHIQEVPQEKIEQWKSLYEKYKSILKVNSKSVLEI
FT                   IEFLKRKYVIVEETSEEFKHVVINNIKLNKPFSQKISSDKELKPIVFTIPNEGNAKKLY
FT                   DTQEETYSGCKIIVGMEFETGCVFVEGSDELNDEITSFKGLDKYDISNYYLVANYIRCL
FT                   KKYKLID"
FT   CDS             504592..505365
FT                   /transl_table=11
FT                   /gene="spaF"
FT                   /locus_tag="CDR20291_0420"
FT                   /product="putative lantibiotic ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02194"
FT                   /db_xref="GOA:C9YIM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM6"
FT                   /protein_id="CBE02194.1"
FT                   /translation="MLFFHVSILLVIDLRYYKKGEINMKDLILETKNLSKRYGEQMAVN
FT                   NVSLQIERNSIYGLLGPNGAGKSTTLKMLVGLLRPTDGRIIFDRKPWKRESLAKIGSLI
FT                   ESPALYGNLTAEENLLVHTKILGIPKDKIYEVLEIVNLKNTGKKRASQFSMGMKQRLGI
FT                   AIALLSDPELLILDEPTNGLDPFGIQELRELIASFPKKGITVILSSHILSEVAQVVDNI
FT                   GIINGGRLLFQGMPDPNENLEEFFTDVILKGGQNR"
FT   CDS             505362..506132
FT                   /transl_table=11
FT                   /gene="spaE"
FT                   /locus_tag="CDR20291_0421"
FT                   /product="putative lantibiotic ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02196"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM7"
FT                   /protein_id="CBE02196.1"
FT                   /translation="MNALQSELLKYKRTFMGKLIVFFPVSFAAYAFIMQSTLMQNPLSQ
FT                   TTSWAWQSLLALIFNWWSFLFLPIGFALFATLVAFQEKKAGNYRALRTHNVSPMTLWIN
FT                   KVIAMAVYSFISTLVLIVVTIITGLILKAGPVPFGQIIGASIVCWVVSLAILPLQLWLA
FT                   TWKGMFLSMGVGALGMIFGVLAATKPFWIAVPWSWAVRMVCPIINIHPNGTILEAGDPL
FT                   LNTSVIPIGIVVSLVVFIVLTALTAAWFNRRDDK"
FT   CDS             506129..506905
FT                   /transl_table=11
FT                   /gene="spaG"
FT                   /locus_tag="CDR20291_0422"
FT                   /product="putative lantibiotic ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02198"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM8"
FT                   /protein_id="CBE02198.1"
FT                   /translation="MIKLLSSEWLRAKRTAVQWLTLCMPIIFSLCVVFYLTTKSGSTQE
FT                   FAFEGFFTVWTVFIIPIGVGILAGFIVQEEELAGNFNGFLCVGISRVRLYLGKFLFLLF
FT                   CLTICTFIATLILCIGMSIAVPSGATIWLFLSAAGLVVIGTLPLLAIHLWVSFAWGMGA
FT                   SIGISIGGILMAAILGLTSVGEKVWAFVPWTWPVKLGMLPGIYFIKEAGTISTEAFYSK
FT                   VMQTASIELIVVAIGLIIFLIGGVIWFKMWEGRKSY"
FT   CDS             506990..507652
FT                   /transl_table=11
FT                   /gene="spaR"
FT                   /locus_tag="CDR20291_0423"
FT                   /product="putative lantibiotic resistance two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02200"
FT                   /db_xref="GOA:C9YIM9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIM9"
FT                   /protein_id="CBE02200.1"
FT                   /translation="MDLVMLLEDELKAKGHEVLIAYDGQAGIELSKQEPDLIILDIMMP
FT                   KMNGFEVCQAIRDDVLCPIIFLSAKQSETDKIKGLTFGGDDYVTKPFGLRELMARIEAN
FT                   LRREKRSQYINEENKRSTLYFGKLCLYMKERAIKIDGKNIDLTKIEYDIVELLALHAGQ
FT                   VFSREQIYEKVWGCDSEGDSSTVVERVKKIRAKFSAVTPEKEYISTVWGIGYKWNKM"
FT   CDS             507671..509095
FT                   /transl_table=11
FT                   /gene="spaK"
FT                   /locus_tag="CDR20291_0424"
FT                   /product="putative lantibiotic resistance two-component
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02201"
FT                   /db_xref="GOA:C9YIN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN0"
FT                   /protein_id="CBE02201.1"
FT                   /translation="MKNQSLITQFRHTFIFIIIASIVATVITYVFALYLYIHSLNKDIY
FT                   PPNYYERQVPRIEKYINEKNITLLSQSNEEGLKRTIRGDDMPYQVVDNNGNILYGTNPK
FT                   KLFKTKEELFNNFINKTVRKGGYIHTVPIKGDNGKIEGAVILFYQVKITFANSRGRFVF
FT                   AVIIMALFSPFIYIVGFTRWLSKRFVKNINQPLHLLIDASKKIKEKDLDFEIDYYSDNE
FT                   LGKLCSAFSEMKDELKGSLSAQWKMEQERVEMVEALAHDLKSPLSIILGYTDALIGNNT
FT                   DDNEKLHRYLTVIRENTEKSAALVQKMQYTSDLEKSNIQLNLVPINLPEFLRQKVQDYE
FT                   LQAHQKEVELILKMKGNIQSPIQIDVDRLTRIFDNIISNSLQYTPSGGNISITVKDEKN
FT                   CISYEICDSGRGFSSKDLKKALDKFYRGDEARQTKGGHSGLGLYIVKQLVEQLGGSVKI
FT                   ENSKSGGACVKFWHSI"
FT   CDS             complement(509335..511803)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0425"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02203"
FT                   /db_xref="GOA:C9YIN1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN1"
FT                   /protein_id="CBE02203.1"
FT                   /translation="MKNYLSLSIKELKSQKLMTTFIIIAIVLSTIMTTVVGQSIGILQN
FT                   LRIEQARSFNGDRHVSFHQLTKNQVDDIKKDDRVYQAGTSITIGSSKIKDSGISVLVKE
FT                   YDKTGLSNYPKLMKLKSGHLPKDKNEIALDENTLKLMGIKPRLGVTIPMNLDISLLNDT
FT                   IPPYNYTANFKLSGILEDDYTGYVSGIVNGIVGKGTSENLLPKRYILSSLDFKIKQQEK
FT                   FQEIVNQLAKKINLSHNSIQYNWIYLNALKIQFEKDENSSNSDGISMIILVSLFVALLV
FT                   LLASGLVIYNILKISVTKKIKEYGCLRAIGAEPNQIYKIVILQILILCTVAIPIGAVIG
FT                   IISSKGITGMVTNILNPDILLANDNKEITELIHKNTTAYMFPLVLSTNVSLIFSFISAL
FT                   PSAIYASRVSPKIAMAGSTTKIKRKIKREKAIKNFERHLAWLNLKRNKGRTIITILSLF
FT                   MSITVFVALSEFSNVLDVSRSVSNLKEGDFSLTNEISGFDKSTLDKIDKMKNVNRTSFI
FT                   KYSEYKQGEIDTDINFENSGEMLKIIGIDEQTLKDLMPSITDSILEDFKNGSICFIKNP
FT                   IAISTPGVKTRHTNLKPKDSITINKKQLDIYSTVDKMFFLQGNGWINGVDVIVYNSVYN
FT                   TLTNKNKFNQINIYAKDKSKLEQIRLSIEQICENNPGSHWISYIESDKQLKESFKQIEF
FT                   LAWAVILFVGLIGTLNIINTTHTNINTRTNEIGVKRAIGMSNISLYKMFLWEGVYYGIF
FT                   AAIFGSIAGYASAIIINMATIEKLDFTNIPITSILQATIISVLACIIATLIPLRKVKKM
FT                   NIIDCIDINL"
FT   CDS             complement(511806..512474)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0426"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02205"
FT                   /db_xref="GOA:C9YIN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN2"
FT                   /protein_id="CBE02205.1"
FT                   /translation="MIIKAKQLSKIYGSNNNKVIALNNVNLKINSGEFVSVIGPSGSGK
FT                   STLLHILSGLDNPTSGQVLLDDKDIYKHTEKELSALRRKSFGFVFQQFNLLPVLTASEN
FT                   ISMPVLLDKKQPDKDYLNEISSLLGIADRLNHLPHELSGGQQQRVAIARALIAKPDIIF
FT                   ADEPTGNLDSKSGSEVMNLLIKTSKQFGKTLVVITHDDRIAKLADRKISIIDGVLMEVK
FT                   "
FT   CDS             complement(512760..513233)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0427"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02207"
FT                   /db_xref="GOA:C9YIN3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN3"
FT                   /protein_id="CBE02207.1"
FT                   /translation="MLSSTFCSLPFWICYFWCGISDILDGLIARKLRQQSGIGAKLDSI
FT                   ADFIFAVTILVTVGKNIALPMYLWWCIVAIALLRLISYSIGFFKYRTFSSLHTLMNKIT
FT                   GISIFAFPLLYICFGLDVAGIMICIVAFLSSFEEIAIMIKSKELNRDIKSIFM"
FT   CDS             complement(513504..514646)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0428"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02208"
FT                   /db_xref="GOA:C9YIN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN4"
FT                   /protein_id="CBE02208.1"
FT                   /translation="MSLKKAFFVLTLSSLIIASVLTTFAYILLNNLYNSIQDKYLKTPI
FT                   NTGIITIVQNNVNQFSDYDKTLLNIINILQLVLPLIFFIGLLLLADIIFYKVKLKTPIE
FT                   ILNKGAMEISNNNLDFCLEYNNNDELGNLCNAFEKMRSELNKNNINMWTMINDRKQLNA
FT                   AFSHDLRNPLTVLKGYSNYLTKYIPTGKLSDEKILSTTQLMSEHINRIEYYVENMSNAQ
FT                   RLEDLVVSKSMSNINKFIENLDENISIIAKQEGKSFTLKSQINNINLFFDENIILRVVE
FT                   NIISNAFRYARNNVSILIYLEQELLTFVIEDDGIGFSKESLKLALRPFYRDKTLNDSNP
FT                   HFGMGLHISKILCEKHGGSISIENNSTNSAKITAKFSTRN"
FT   CDS             complement(514652..515326)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0429"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02210"
FT                   /db_xref="GOA:C9YIN5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN5"
FT                   /protein_id="CBE02210.1"
FT                   /translation="MNNKILVVDDEEGIITLLKDYFEMNGYEVYTAQSGKDSLKKISKN
FT                   PDIILLDINMPEIDGIEVCNRIRDYVSCPILFLTARIENTDKINGFRAGADDYIVKPFD
FT                   LDELGARVSAHLRREQRKSNQTKIKFYNDLTIDYEKRLICIYNNQISLSKKEFDIVELL
FT                   SMNPGQVFDKEKIYDRVWGYNSNGNSDVIMEHIRKIRIKLSKHTLENYIETVWGVGYKW
FT                   IK"
FT   CDS             complement(516147..516974)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0430"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02212"
FT                   /db_xref="GOA:C9YIN6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN6"
FT                   /protein_id="CBE02212.1"
FT                   /translation="MNFYKIAVCQMMTTENKIENINHAVDMVTEAAINGAKIIVLPEMF
FT                   NCPYENKYFPKFAEEYPGETTTILSKLAEKHGIYLVSGSIPELEYGKIYNTCYVFDKNG
FT                   ALIGKHRKMHLFDIEVTGKVSFKESDTLTAGNDVTVIDTEYGKVGIAICYDIRFPELSR
FT                   LMALKGVEIVILPAAFNMTTGPAHWELSIRMRALDNQIFYVGAAPARNMNASYIAFGNS
FT                   RISDPWGRIIAQADEKECIIYADIDRDLIPDIRQQLPLLKHRRTDLYELNTLK"
FT   CDS             517356..517676
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="CDR20291_0431"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02214"
FT                   /db_xref="GOA:C9YIN7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN7"
FT                   /protein_id="CBE02214.1"
FT                   /translation="MKWLFLFVAGLFEVFWAFQLKNSHGFSKLTPSILTVVGMIVSFYF
FT                   LSLALKHLPLGTSYAIWTGIGTVGTAIVGMAILNEPISISRIACIGFIVVGIVGLKLLS
FT                   TN"
FT   CDS             complement(517809..518489)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0432"
FT                   /product="putative
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02216"
FT                   /db_xref="GOA:C9YIN8"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN8"
FT                   /protein_id="CBE02216.1"
FT                   /translation="MKKVYQGKTKDVFELDNGNYLLKFKDDVTGKDGVFDPGENSVGLS
FT                   IDGIGRANLETSVKFFEILNNAGIKTHYVSANLEEATMEVLPAKVFGNGLEVICRYRAV
FT                   GSFLRRYGSCVEEGAKLDCYVEATLKDDDRCDPLITSEGLEALNIMTQAQFDSMKSMTQ
FT                   KISNIVRDTIAEKGLELYDIKFEFGFYNDEVILIDEIASGNMRVYKDGVIVDPMDLTAL
FT                   LLDK"
FT   CDS             518885..519937
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0433"
FT                   /product="putative sugar-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02217"
FT                   /db_xref="GOA:C9YIN9"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIN9"
FT                   /protein_id="CBE02217.1"
FT                   /translation="MKSVRFYGIRDTRVEDVDVPKILEKDDVIIKVKVAGICGSDISKY
FT                   SKTGPHMVGEILGHEFSGEVAQVGKEVRSFKIGDRVAVCPAMPCFECDECKKGLYSRCN
FT                   NVAIIGNKELGGCFAEYTKVKERNLIKIPDEISYETAAALEPVCIAGHGLFRSEAKVGD
FT                   TVVVLGTGTIGLFSIQWAKIFGSTKIIAVDVFDEKLDLAKELGADICINAKEKNIVEEI
FT                   KRLTDGDGADIVIESAGTPMTCGQVLLLAKKGGTVLYAGVPYGDVALTREQFEKIVRSE
FT                   LTVKGTWFGNSFPFPGKEWSAGLYHMQKGDMNVEKLVTHRINLEEVPAYFEKVYKRDIF
FT                   FGKIMINIDN"
FT   CDS             519984..520400
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0434"
FT                   /product="PTS system, IIa component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02219"
FT                   /db_xref="GOA:C9YIP0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP0"
FT                   /protein_id="CBE02219.1"
FT                   /translation="MIHMTGIIIATHGNMAKAMLESAELIVGKQENVETLGLNHGDSID
FT                   EFSRRLEDRIEKYKDEGVLVLLDFYGGTPFNTSAIIINKFAKVCELECLTGVNLPMLLE
FT                   LFLNRDTMKLKDLKNLCEEVGISGIKDVKTVLKL"
FT   CDS             520429..520902
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0435"
FT                   /product="PTS system, IIb component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02221"
FT                   /db_xref="GOA:C9YIP1"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP1"
FT                   /protein_id="CBE02221.1"
FT                   /translation="MSNIALTRIDDRLIHGQVITAWCKITSAKRIVIVDDLVVKDPFIV
FT                   QVLQMAAPSTVKVEVHDVESGAEVLKSHNGDEHLIVLVKYPKTVLGLVNSGVDLKELNV
FT                   GGMGAGLGRKSFYKNISVSDEEKEIFRELISKDVKCFIQIVPDAKKIDVGTLL"
FT   CDS             520949..521707
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0436"
FT                   /product="PTS system, IIc component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02223"
FT                   /db_xref="GOA:C9YIP2"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP2"
FT                   /protein_id="CBE02223.1"
FT                   /translation="MHISLIQAVLIAIFYYLSWSPWLTYVGFFTWNRPLLAGFVTGIIL
FT                   GDPVQGAIIGAGINMIYLGFISAGGAQMGDPAFAGYVGTALAIASKLDVSTAMAIAVPL
FT                   GTVATVLWIGKMTVNSFFAHWADREVQKGNVDRVAFINIVPPQILLFAMSFIPALLVVY
FT                   FGPNAIDGMLEVMNENVLHVFNVIGAMLPALGIAMNLKLIGNKFTMPFFILGILMAVYF
FT                   KVDIIVISVIGVILALTITSIKYGKDSATS"
FT   CDS             521731..522570
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0437"
FT                   /product="PTS system, IId component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02225"
FT                   /db_xref="GOA:C9YIP3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP3"
FT                   /protein_id="CBE02225.1"
FT                   /translation="MSDIKNEVSKKTLSKKDVIKSWLRWFFFAQSNYNYERLQSTAFSH
FT                   SMLPVLKKLYPDKEELKQEVETHLAFFNTEPICGCVIHGITIAMEEEKANGADEISGDG
FT                   MNAIKTGLMGPLAGIGDTLTQGVITPIVLAVCIGLTEGGASIAGPILFVIAQYIIMTSI
FT                   SFGMWTNGYKYGKKAVESILQGGIVNKVIEGASILGTLVMGGLVGRFINLSTPISYTSG
FT                   DFKFSLQTDLLDKIFPGLIPLVLTLLVLFALKKGLSPIKIMFILIVVGAITGILGLF"
FT   CDS             523021..523668
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0438"
FT                   /product="dna-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02227"
FT                   /db_xref="GOA:C9YIP4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP4"
FT                   /protein_id="CBE02227.1"
FT                   /translation="MNILIADDEISMLKILCAYFKKENFNVFTAKNGEEALDIFYENKI
FT                   DLAILDWMMPIIDGIEVCKEIKENSNTRVLMLTAKSQSEDEIEALNIGADEYIKKPFDP
FT                   RVLIIRAKKLINYKNTINIKDLKIDFGSSKVFKGDKELLLTKKELELIRCLINNKGMVL
FT                   SREKLLDLVWGLDYEGDFRTVDTHIRRLRVKIGEDIIKTYRGLGYSLEDFND"
FT   CDS             523661..525055
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0439"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02229"
FT                   /db_xref="GOA:C9YIP5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP5"
FT                   /protein_id="CBE02229.1"
FT                   /translation="MTKLNKKLSISISIVVVVVYIISIIINSMFIHRYYLHEKRNILDN
FT                   VENEIKDKDIDKLKSDITLIEEKNNIDIVYIELDKNHKDKGNIDKINQDLLNAFWKKGL
FT                   SLNKFWIEENSLNNIDKKSINKIYNQGKTKYSLLVKFIKKDNYLFAISIPIEHSEETIG
FT                   IVNRFNIIMGIFSVVIITILTFILSNRVIKPMERLKFLSKDISELNFRTEDIKTNDEIE
FT                   ELAYSINIMSEKLEKAHNELNKRNENLKTFISDASHEMKTPIALIKAYAIGMKDGLDDG
FT                   TYTDTIIEQAENMTNTINSLLYWAKYEKKERSLCLVDLKERLYKSLKNYELLIERGSIS
FT                   VKCSVDDKELIISSDEDSIDMVFNNLISNAIKYTNNNEIEINLFEENERIILSIKNGID
FT                   YNMGDDIENMWKPFYVLEKSRSKELSGTGLGLTIVRTILEENNFRYRVEICDGIIEFYI
FT                   IFIKVI"
FT   CDS             525456..528968
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0440"
FT                   /product="cell surface protein (putative
FT                   hemagglutinin/adhesin) precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02230"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP6"
FT                   /protein_id="CBE02230.1"
FT                   /translation="MDKGEENKMKIPKKIAAMLTVTMIAGSSTAGIASAQTVATNLTGQ
FT                   ERYETAVKISQDGWKNADEVVIVNDSSIADALSATPFAKAKNAPILLTSKDKLNDKTKA
FT                   EIQRLKAKKVYLIGGTSVLSTNIEKEIKDLKISFERISGAERYQTSLELAKKLDAISDV
FT                   KKIAVVNGEKGLADAVSVGAPAAQNNMPVILADSKNGTAVADKFIKDAGITQSYVVGGE
FT                   SSISEAVKNKLPNSTRLGGTDRNDTNAKVIKEFYKKTDLKNAYVTKDGMNKQDQLIDAL
FT                   AVGVLGAKNQSPVVLVGKNLSASQKSLVNSKSFDKITKVGGNGNETAFNEMKSLQEVKT
FT                   VEAKTISELKSAIDKATANDVINFKPTSEVKEAFTIQTDKAITVNLNGTYTKTVTINMP
FT                   NGDVNNYAKVDDVVIDDVKDGTFVNYGKITNLKVNDKNGAKIENNSKGEIGSLTVASGA
FT                   SQVKVTNGGKITTVTNNSKGTTIDNKGTISSVKGDNSPTISGNSPSSNSSGGSSSSGGS
FT                   SHGGGSSSSKVDKVVLKNTITAANKLYNEAIEGTNVGEYKVGSKAIYKTAIDKAQAILD
FT                   KSGVTQKEVNDAVTALNTATDTFKAGKVVAVDKTALQDAVTAATALHAKATEGTAEGNY
FT                   AVGSKATYKTAIDEAQAILDKSDATQKEVNDALSALNTATETFEAGKVVAVDKTALQDA
FT                   VTAATALHNGATEGTAEGNYAVGSKATYKTAIDEAQAILDKSDATQKEVNDALSALNTA
FT                   TETFEAGKVVAVDKTALQDAVTAATALHNGATEGTAEGEYAVGSKATYKTAIDEAQAIL
FT                   DKSDATQKEVNDALTALNTATETFEAGKVVAVDKTALQDAVTAATALHNGATEGTAEGN
FT                   YAVGSKATYKTAIDEAQAILDKTGATQKEIDDALSALNTATDTFKAGKVVLNKTALQDA
FT                   VTAATSLHAGATEGTAEGNYAVGSKATYKTAIDEAQAILDKTGATQKEIDDALSALNTA
FT                   TDTFKAGKVVLNKTALQDAVTAATSLHAGATEGTAEGNYAVGSKATYKTAIDEAQAILD
FT                   KTGATQKEIDDALSALNTATDTFKAGKVVLNKTALQDAVTAATSLHAGATEGTAEGNYA
FT                   VGSKATYKTAIDEAQAILDKADATQKEIDDAVTALNTATATFEAGKVPTTIALMLSRIL
FT                   GFMK"
FT   CDS             complement(529409..530653)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0441"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02232"
FT                   /db_xref="GOA:C9YIP7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP7"
FT                   /protein_id="CBE02232.1"
FT                   /translation="MEDEILKGKIKQLTILALIFIFITPVFAFADTPPVPNSSRAALLI
FT                   DQETKRILFEKNIDEKMPLASLSKMMTFLLAIEAVDKNQVKETDMVKIDKSTASVGGST
FT                   CKLKDGDEISLGELMQGLMLVSGNDAAIAIAKHIGKTEKNFVNMMNKKAEEIGMIDTYY
FT                   FNPNGLPIYTDPEHKEPPIENMSTAHDIVTLGKYMYDHYENQVTRITTMQVYNDTKKDF
FT                   THYNTNPLLVSVPGVDGIKTGYTDNAGYCLAFSMMVPKDAKNERNHRLIGVVLGDGNKK
FT                   NRISSSATLLKYGKDNFHSKKIAHKGDIIETPCVDGIDDFKITVKVDKDLYGVVSDNEN
FT                   INPKVVFKNMNYPIHKGDIVGVAKYYNDSGKFVGSVDVKSESNIGCIPLKDKIKIKVAK
FT                   INKKLEIKNSVCFKV"
FT   CDS             complement(530696..533530)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0442"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02234"
FT                   /db_xref="GOA:C9YIP8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP8"
FT                   /protein_id="CBE02234.1"
FT                   /translation="MLRKDKVLLSLHKLCENMTLKDLQSDKTGFTTIEIANHSSLDRSN
FT                   TSKELNNLYNEKKVLKISGKPILFLHVSIIENLIGRTLNSDEFSINNCNELLKSSKNDS
FT                   EDIFSTLLGHDSSLKLPIEKAKSAILYPPKGLNTLLIGPTGVGKSTFAETMYKYAVESK
FT                   IFSSESKFVVFNCAEYAENANLLLSNLFGYVKGSFTGANKDKFGIVAQADGGILFLDEI
FT                   HRLPPEGQEMLFLLMDKGIYRRLGESDIVHKANVFIVCATTEDIHSSLLGTFLRRIPVT
FT                   INLPALQDRSLKERLSLIKYFFIIESKYTNATIKVHKDVIKSLLLYDCFGNIGQLKSDI
FT                   QLMSARAFLNYKTGLKDNIEIDLSLVPDYIYIGLLKLNENRSNLNKLSELDYMLFYEFN
FT                   GNNLEVEYTKELSKYNIDTSNNGFKYSTEIPYLENDIRSMFINYMEKYSTKLLSISSVT
FT                   HSDYTSNEIFKVINPKIYYAVEHSLKEAEKISRNKYTKQTYIALSMHISALIENINQDT
FT                   YNPKYNLYNDKIFLDKDLNISKIVLSIIENDLQTSLPKDEVKFISMFLNSMYLEPNNQS
FT                   ESIGVIILAHGNSTASSMCDVANSLLGTNHCNAIDMPLDVKVSTILDKTIELVKECDEG
FT                   KGVLLLTDMGSLIAFGELISEKTKIKTRSIEMVSTPIVLEAVRKSTLPEMTLDELANSL
FT                   SSLNPYIGRAAIDSTEINYPEKSREYVIITTCITGYGSAMKVADFINSSLKNIRKYNIN
FT                   LVPHNIESFKMYKNKFSNTKILAVVGSVDFNVANTPFIHIEELLNGYGLDMLNKIIEGT
FT                   FNANSITNIKETNLSYNSLIINFMTQNLELLDSVKLFNYVNSSLFTIIELIDENLKSKF
FT                   KLGYILHCSFMIERCFKNTTFPYNNITELISKNHELYSLIREAFKPTEAYFNILIPDEE
FT                   IAYIIDMINEYLNK"
FT   CDS             534217..535014
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0443"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02236"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIP9"
FT                   /protein_id="CBE02236.1"
FT                   /translation="MNNTIKEWEICFVDIDRILNFSSNAGKAMLQSGGETYRVEETIAR
FT                   ICQSFGIDHVDVFATPTAVMASVFVDGKLHSAIKRISSRRVDLNLVHEVNSLSRAISIN
FT                   NLDIELCEKILDEISEDNYYSDLITIFFAGIAAATFSILFGGNVEEFIAAFTVGILTKF
FT                   VIMYLSKSSLNDFFVNAIGAVIIASCSILILKLGFIKTLDHLIAGAIMLLVPGLALTNA
FT                   LRDLLDGQLISGLAKLAEVFFVGVSIAVGMFLVLGLYFKLGGI"
FT   CDS             535015..535509
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0444"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02238"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ0"
FT                   /protein_id="CBE02238.1"
FT                   /translation="MHLFIEVIAAFFTALSFGVLFNMKGKNLILAGIGGSIAWFSYKFL
FT                   LNMGVTENLCFFIATVCFAIYCELCARIYMTPATTLSVCCLIILVPGYGIYNTMYSVLT
FT                   NNYIKAVEYGVSTLSCASSIALGLVFITTVFRKVNLYGVLTKIKENEKYKKSINKIKQQ
FT                   K"
FT   CDS             535735..536913
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0445"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02239"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ1"
FT                   /protein_id="CBE02239.1"
FT                   /translation="MEKLSDKRRVKAVSMETFVFIVLLAVGFGYVGSIMGAGMMFKVIM
FT                   STAHALLLDTVFLIMAMAVLAGALSALLSEFGVISLVNKIFKGLMRPIWGLPGASIAGV
FT                   VATYLSDNPAIIPFAKDKTFTQYFKKYQVPALCNLGTAFGMGLIVTTFMIAQGKEYVLP
FT                   AIIGNVGAIIGSIISVRIMLTFTKKYYNYDPKNDTEKQINDKGAKLEEFREIRDGNVFQ
FT                   RTLDAILEGGKLGVEMGMAIIPGVLVVCTLVMLLTFGPSTDPATGQAVYTGAAYEGIKL
FT                   LPAIGDKISFIIEPLFGFTSPEAIAFPVTALGAVGAAISLVPEFIKSGAITPNDIAVFT
FT                   AMGMCWSGYLSTHIGMMDALDARPLAGKAILSHTIGGLCAGICAHFIFMLVG"
FT   CDS             537167..538774
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0446"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02241"
FT                   /db_xref="GOA:C9YIQ2"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ2"
FT                   /protein_id="CBE02241.1"
FT                   /translation="MKKERLQHEDLKEYDYDEDGYLSKKIIIKDFIKTILVMTIATGIS
FT                   VVFEKVGFNESNIILVYILGVLFATSITYGYFFGILSSVIGVLSFNFFFTHPLYTFLAY
FT                   RKDYPMTFCIMLMAAIITSTLTSRIKREVRLSHKREKMIRLLYENNKTLLKAKNKNQII
FT                   EFCGSNLVNILNRTVIVTIADENNNLGKPSIYICNNDGSENIFHSVLEKEAIKEAFRTG
FT                   NPVGIGTKYCKNSSAYYFPIKGQESNVLGVIGVACFKIDIITENEKILLEAVSTQVALA
FT                   IDRENLFEKNKKANLEAERERLRGNLLRSISHDLRTPLTSILGSSSTILENDDVIDKET
FT                   RVELLKNIYEDTSWLTHSVENILSMTRIDEGKLDIEKRPEVVDEIIAESILRVKKFANS
FT                   RDIKTNIPDEIIIVHVDVLLIEQVLVNLIDNAIRHTPKNSKIELTVKKESNQVLFEVAD
FT                   NGKGIPNEDIGNIFNRFYTKNKSRNLERRGIGLGLEICKSIVEAHGGEIVAFNNPSGGA
FT                   TFRFSIPMYDEEGKDKWK"
FT   CDS             538765..539469
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0447"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02243"
FT                   /db_xref="GOA:C9YIQ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ3"
FT                   /protein_id="CBE02243.1"
FT                   /translation="MEIKPLVLIVEDDKPICKFIKVSLETQNYRCVETDNGGTAISLIH
FT                   SLDPDLIILDLGLPDIDGIEVIGRVRACAKTNKIIVVSAREHERDKVEALDGGADDYLT
FT                   KPFSVTELLARVRVALRNKAQQDNINNDAPKSFEVKNLKIDYENHIVSINGEEIHLTPI
FT                   EYKIIELMSKYSGRVLTHKFIIDKVWGNYYESENQSLRVFMASIRRKIEKNPAQPEYIL
FT                   TEVGVGYRMADE"
FT   CDS             540637..543735
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0448"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02244"
FT                   /db_xref="GOA:C9YIQ4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ4"
FT                   /protein_id="CBE02244.1"
FT                   /translation="MDVINLIDELDEIVYVSSLDTYELLYINEIGKKAMGINDISHVKC
FT                   YKALQGKDSPCEFCTNSILKEDEYYIWENTNTRTNRHFILKDKLIKWEGKHARLEIALD
FT                   ITEKEDISKSIAEKLEIKELLVGCIKHLITESNFSDAVNLVLTNIGKFHKADRAYVFEV
FT                   SEDRKKVTNTYEWCNEGVDEQKQALTNLDINELKNWFLLFEQKGFVIIDDIENIKEEQP
FT                   IEYEILKPQKIESLMTSSLKQDDKVVGFIGVDNPHKAVGDTSLLTSLSYFLLTEMKKRK
FT                   VENKLNYMSYYDFLTGAYNRNKYIKYIDNFQKGKFKSIGVVFVDINGLKDINDNFGHAN
FT                   GDSAIVSACVIIKKYFHSYNVYRIGGDEFIVLCEDISKQLFEELVSWLSEEFKDEMIYS
FT                   VAVGSIWSDDNIDIHKLIKVADERMYQDKKRYYNKNKLRNNEMEVISDLADSTNNILFK
FT                   HKELVDKVYFDDLMIKGYSKAYEKLAYNTYDIILSICIDTNLITPIYQSESNIFSFPIK
FT                   ENLEKTFSYIKKHLIHPDDIILFDDNHLLKSLDSLNNSKQDDLELNFEYRRLGIDKKYY
FT                   WALIYMLKISSKNKLGEKQTHILVAIKNIDYLMQLHKNQKDILTGLYNYESFCEQTSLM
FT                   LKRYPDKSYAIIMMDIDKFKVINDIYGVRGGDKALIYVAELIQKNIGSNGICCRMYADV
FT                   FCIFYESYSDRDVHKLIYKIKNSLNRKKFEYMLVPCFGVYKILDNNIPITNACEMAGYA
FT                   HKKVKKQSINNYIFYDDTIRNDALEEKQMEREMEYALENGQFHVYLQPKYNLNANKIVG
FT                   AEALVRWVHPEKGIIPPIKFISLFEKNGFIIRLDMYVWEQVCSLIRKWIDLGEEPVPIS
FT                   VNVSRLHLHNPHFKEIVLSLINKYSIPKSFLELELTESLFIKNIKLFTKIIADLRMDGI
FT                   VLNMDDFGSAYSSLNMLKNINIDTLKIDCGFFNEEGITDREKIVLRHTIAMAKDLDMDV
FT                   VAEGVETKEQAEFLVSLDCVVIQGYYYCKPIPSADFEKLLYQK"
FT   CDS             543858..545144
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0449"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02246"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ5"
FT                   /protein_id="CBE02246.1"
FT                   /translation="MIVGIIGPSDSGFKIKDDLKQIDSDLKTKIYVREKVVDTIEVISK
FT                   CEDECDAIIFTGCAVYEFIKSKYEISKPHSFVPRSGTSIMKAFWAIKSANIKLDKFSID
FT                   VVDRYVVEDALKEFDIKATSVFCNPFSLEVGESELVEWHIKLFEENKTDIMLTGFGAVY
FT                   NELKERGYPVFRLQATIQLIKESYDKVKSEYALSKARFSQIAVEILSLIDYKEKIDNYY
FT                   SDMIKKSDMDKLVVNYVRSIQGSLFLLGRNDYVVFVHKGVADNEYNYDKLFNLKREIKD
FT                   MGFSLSIGIGTGVTAYQAENNAHKALRHSIDSKEIGIYLVDEDENIRGPLASENELNYS
FT                   LMLSDEKVIEISKKTGMSCESVAKIIAISENRKSKIYDSKELAEYLNVSERSARRILNK
FT                   IVNAGLGRICAKETSIGGGRPKNITEILF"
FT   CDS             complement(545730..546836)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0450"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02248"
FT                   /db_xref="GOA:C9YIQ6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010162"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ6"
FT                   /protein_id="CBE02248.1"
FT                   /translation="MLDKNRLINNFMDMVRIDSPSNQELEMSKWLVNYLKERNIDAIID
FT                   DAGEKYGGNTGNVIAYIKGEEGSRPLCLCAHMDQVQPCLGVKPILDGNVVRSDGTTTLG
FT                   ADDKAGIAAILEALEHVTTEKIPHRDIYLCFTICEEAGMHGVKNFNPDNLPCKDMVILD
FT                   SGGAIGSIAYKAPAQQSIKISFHGKKAHAGIEPEKGLNAILVASHAISNMHIGRIDPLT
FT                   TSNIGKIEGGGATNIVTDKVTLTAEIRSHIPETLEYELNHMEKCCKDAASKFNTTYTFE
FT                   HSMSYPSFELSRDSHVFKLSEEAIRQVGVVPNPMVIGGGSDANILANLGYNCAILSLGM
FT                   YDVHTVNEYVNIDELYDTAKIVYHMIKL"
FT   CDS             complement(546871..548412)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0451"
FT                   /product="putative aminobenzoyl-glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02250"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ7"
FT                   /protein_id="CBE02250.1"
FT                   /translation="MNDNVVKKKNFFDRTLNRIETVGNKLPDPVTIFLGLCVLLLILSS
FT                   LVGSMGISVVHPGTGETITAVNLLTVEQLQILLGNIVSNFQGFAPLGLVLVTMIGAGVC
FT                   DKTGLMTATIKASVSKIPETRVTLVVMTIGMLANIASDAGTILFPPLAALVYLGVGRHP
FT                   LIGLFSGYAAVCLGFAANIMISVNDILAASFTVPAAQMIDSGFQANATMNLFFMIASTF
FT                   VLILLATWVTEKIVAPRFGKYEGNAELDVDGSLSDVEKKGLKKAGISILIYVAIIVALS
FT                   VIGKKPFLADPETGDLLSNNAPLMKGMVPIIALAFFIPGVVYGKTIGKIKKDKDVVSIM
FT                   ASAMSDMGGYIILAFAASQFLQLFTNSNLGLILAVKGGEFLKSAGINGPLLLIGFIILS
FT                   CFINLFIGSASAKWAILAPIFVPMFMMVGYNPALTQMAYRIGDCITNPLSPLFPYFPII
FT                   LAFTRKYDKDAGMGTVIANMIPYSISFLIVWTILLILFMVFNIPLGPGILPSYSM"
FT   CDS             complement(548774..549520)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0452"
FT                   /product="metallo-beta-lactamase superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02252"
FT                   /db_xref="GOA:C9YIQ8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ8"
FT                   /protein_id="CBE02252.1"
FT                   /translation="MFNAGNRIINTWLYPIQDGFVLIDTGYENGFKHFKKRISKFNIKI
FT                   KDIRYIFLTHAHDDHVGFLNQILDESPNTKIVMHDKALEILYKGQNSFIGGCNSRTAFL
FT                   FCQIMKLFGKGEHSFSPLKQEFEKRCILVSDKNRKEIEKELNGKIIDTPGHTADSISLL
FT                   IDDGVLFCGDSAMNGFPSTHKITIFAESKLEFIQSWKTIINTKPKMIYPGHGKPFEYSK
FT                   LEQNLIYVNKINLYPLHNSKDIHRFL"
FT   CDS             complement(549732..551042)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0453"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02253"
FT                   /db_xref="GOA:C9YIQ9"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIQ9"
FT                   /protein_id="CBE02253.1"
FT                   /translation="MNKEQLKSLVIKTIDENREKILKIGQGIYKNPEYGYKEFKTTEAV
FT                   SNFFEQELNLSVEKNIAVTGCKADANSSKKGPHISILGELDGISCKEHKDANEIGASHT
FT                   CGHNIQIAGMLGAAVGLVKSGVLEHLDGKVSFMATPAEEFIELEYREQLKKEGKITYFG
FT                   GKQELIKRGYFDDIDISMMFHASDLGEDKALVGPESNGFVGKKVKFIGKESHAGSAPHD
FT                   GINALNAAMLAINNVNALRETFKESERVRFHPIITKGGDIVNVVPADVHMESYVRARTI
FT                   NGMIDANERINKALMAGGMAVGADVEITEIPGYLPILRYKSLDNLFKNNLEDLGLKGKV
FT                   IDGGDFTGSFDFGDVSHIMPTLHPMIGGVKGALHTRDFEIVDEDLAYIIPAKAMALTVV
FT                   DLLFDNAKDAKDILDTFTPVMTKEEYLTFLEKHDKTL"
FT   CDS             complement(551055..551525)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0454"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02255"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR0"
FT                   /protein_id="CBE02255.1"
FT                   /translation="MFANLNLKKSSYQLLVMSVIGVIILIGQRISVGTSIVTALPGMVM
FT                   LILAAMAAMIIKDLFPKSIFPAFGFATIIGLLLSMPYSPTSEVFLTNTNNINFMAITTP
FT                   LLAFAGISVGNKIEALKEMSWKIVIISLIVFTTIFFACASIAHIVLSIQGKI"
FT   CDS             complement(551529..552380)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0455"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02257"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR1"
FT                   /protein_id="CBE02257.1"
FT                   /translation="MEINKKHFIQVFLTCLILVVICEFIGQRTIAIGKASIVLFPMLYA
FT                   VIIGLIITPDLLGKKIKALKKVVGEKEINIAGEVVGIALVMLGIKYGTTVGPNIDKIIQ
FT                   AGPAFIAQEFGHILAPIVALPLALMFGMKREAVGATASISREPSLGVISEKYGINSPEG
FT                   SGVLGTYLMGTVLGTIYFSVLGSISIYSGLHPYALGMACGVGSGSMMTAAAGSLSTMVP
FT                   PEMADTILAYAATSNMMSSITGIIFLVFVSLPFTNFMYKILEPKFSRNKKTKEIKSTEG
FT                   EC"
FT   CDS             553305..554216
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0456"
FT                   /product="DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02259"
FT                   /db_xref="GOA:C9YIR2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR2"
FT                   /protein_id="CBE02259.1"
FT                   /translation="MKINRLTEIIVILLNKKLVTAKELADRFEVSTRTIYRDIETLSMS
FT                   GVPVYMTKGKGGGISLIEEYSIDKAILSKKDKESLIVALKTLQATKYPEINSVVNKIGS
FT                   IFGEQNFSNWIEIDFTEWGSNFNEDDKFTKIKEAILRRNTINFNYVNSLSSQTNRTVEP
FT                   LKLMYKSKTWYLYGFCKLKDDFRIFRISRIRNLSIKDEVFSRKIIEEVCLNDSKVIKEN
FT                   TITLKLRFKEKMLFRVFDDFNKDLITKNEDDTYDVITEFPIGEWIYGYILSFGDNVEVL
FT                   EPKDVRDNVITRLRELSKIYSL"
FT   CDS             554391..554888
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02260"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR3"
FT                   /protein_id="CBE02260.1"
FT                   /translation="MNYEIVEINEKIVIGISKETTNKDGQAVNAIGELWKKFMGKGIYN
FT                   AIKGKKNDKTIGLYTDYQGDFTSPYSFVACCEVNSNSDKEKNLEELNTNNTVGESIISK
FT                   VILAGKYAKFVIVGGQKEVGDFWFKFWQMDFDRTYISDFEEYQCNTFDTKKQEIHIYIG
FT                   IK"
FT   CDS             555632..555994
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="CDR20291_0458"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02262"
FT                   /db_xref="GOA:C9YIR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR4"
FT                   /protein_id="CBE02262.1"
FT                   /translation="MENKILIVDDAIFMRMIIKEALSKSGYNNLIEANDGEEACNIFKY
FT                   EKPDLMLLDITMPKKDGLEVLREIKKLDSSAKVVMCSAIGQENMIVEAIKLGALDFIVK
FT                   PFKTETLVKVVNNVLK"
FT   CDS             556156..556677
FT                   /transl_table=11
FT                   /gene="cheC"
FT                   /locus_tag="CDR20291_0459"
FT                   /product="chemotaxis protein CheC"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02264"
FT                   /db_xref="GOA:C9YIR5"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR5"
FT                   /protein_id="CBE02264.1"
FT                   /translation="MINSNVEVLIPMVKILEYNEATNLLGGPENKVVCILLDMKGDING
FT                   MFMFLLDESITQLMLSSLFNKEEAFLDEIEAIEISAIKEIGNIMASSYVNAIASMLNMT
FT                   ISVSIPDICIDMVGAVLNVPMIRFSDVGDKVLFIENKFKMSDNYFTSHILMIPEMSSLR
FT                   EILVRLGLEV"
FT   CDS             556674..557159
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="CDR20291_0460"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02266"
FT                   /db_xref="GOA:C9YIR6"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR6"
FT                   /protein_id="CBE02266.1"
FT                   /translation="MNREIVVNIADMKIAYRPNVLVTYALGSCVGVCLIDKVAGIGGML
FT                   HVMLPYSKDAINIENKCKFADTGINELIKSMENIGANRIYIKAKIAGGAQMFLGSSNSV
FT                   IASIGHRNVEAVKKTLLGLNIPILAEDTGMNYGRTIRFYTETGELLVDSINKGKKKL"
FT   CDS             557202..557720
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="CDR20291_0461"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02267"
FT                   /db_xref="GOA:C9YIR7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR7"
FT                   /protein_id="CBE02267.1"
FT                   /translation="MRFPDDPYLDYGLIDEGIKYLKFKVDEQDFGVELEKVIEITGNQE
FT                   IIFIPELPTYSKGIINLRGKIIPIIDMRLRLKKDELMTTNCMYIVVTEIKDLVVGFVVD
FT                   RVDDIVSLEKSKISPPPRVTIEYSDYFVSGVGELEGKIITLLDLEKLLTDKDEVLIDEL
FT                   INGFDCTIM"
FT   CDS             557835..558815
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0462"
FT                   /product="putative chemosensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02269"
FT                   /db_xref="GOA:C9YIR8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR8"
FT                   /protein_id="CBE02269.1"
FT                   /translation="MFKRGLYMKNKQQGTILVVDDSVLMCDLIDKTLTKDNFKVKKAFN
FT                   AIEAKEFIEEFIPDIILLDIILPDNSGFEFCKEVKSNTRTADIPIIFITSKNTDTDIVK
FT                   GFGVGAIDYMVKPFSMTELKARVIAHLEVKKSQDKLKKINNELESSLEKLNRLVVRDYL
FT                   TGLYNRRHIINQLMEQRRINKYSETSISLILGDIDDFKVINDTYGHEAGDFVLTVISSI
FT                   IKKNCRQIDTVSRWGGEEFLIMLTNTPIEGAKILSERIRKEIKEFDFNYKEHKIKCTIT
FT                   LGVVEVNSNISLEENISLADKAMYEGKNLGKDCSVVSTMKGLKKI"
FT   CDS             558841..560544
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0463"
FT                   /product="putative methyl accpeting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02271"
FT                   /db_xref="GOA:C9YIR9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIR9"
FT                   /protein_id="CBE02271.1"
FT                   /translation="MKREVKLSKLAIVLLIIIVLAVLAGIFSSISSYKAFEKVEKSIND
FT                   MNNLRTQSQYIKDTTREISDVLRRYVFTGEKKNKDIYEKELYGKTRESALNKLEKIGLT
FT                   KSESNKILEAKEISDSLVPTEQSAIKAVESNDKSKAQSIIFGSDYINSQEKMDSLINEF
FT                   QEDIVTRSNSKIVEVKKELQSLILRTIFILSLLIILTIIEYTVIKLKIVIPINRVEKHF
FT                   SRIASGDLRTSIDVEESKSEIGLLVSSVKKMQSMLLNYIDLIDSTLTSIAKGDLRVEID
FT                   QEFIGDFKSIKISLESIINSFNGDFSEINLSAEQVASASEQVAAGAQALSQGATEQASS
FT                   VEELASTINEISDGIKKCADSASLACEVSDQSASQVGFGSRCMDDMMTSMGEISEKSSE
FT                   ISKIIKTIDEIAFQTNILALNAAVEAARAGQYGRGFAVVADEVRSLAGKSAKAAQNTAI
FT                   LIEEAIKTVENGVRIAKETANALDLVVNGVEKTTNYINGISSAVHSQEVAITQILSGIE
FT                   QISIVVQMNSATAEESAAASEEMSAQAQILKELVEKFHLKESEVRESSWV"
FT   CDS             560771..562903
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="CDR20291_0464"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02273"
FT                   /db_xref="GOA:C9YIS0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS0"
FT                   /protein_id="CBE02273.1"
FT                   /translation="MINVNYIEPSMRQMLDMFIFETSLLLEQLDEIMIQIEKEKVFTHN
FT                   NINETFRIMHTIKGSASMMGLDNISALAHSVEDLFYAIREGKIEVLDNDLLFDLVFQSL
FT                   DFIRRDIDELQSRGCISSDYSNFIEGIEEYVSTLELSSSMKSKDNANLESTDEKEAIDS
FT                   NFEYKEDSDVVKIIFEQGCMMENVRAFMLVFELRDYCEFIDFYPKDVETNAESTEYIKS
FT                   YGFYIQFVAKEDKAIVYKTIEDNLYVKEYINISKKEIEMKNTSNNDAVENKLKDNNKVS
FT                   KSYQNNYTEDEIQEDVLNEKTDMEKDSLSEENEHLPISKQSIMSVNLEKLDLLQNIVGE
FT                   IVIMESMVVNSVNSTGVDIDNFNKATRQLHKLTDELQDIVMSMRMIQIAGVFQKMHRIV
FT                   RDMNKKLDKNVELITIGAETEVDKNVIDNLAEPFMHLIRNAMDHAIEPIEERIAKGKEE
FT                   VGKIVLSAENLGGEAVISISDDGRGIMRDKILAKAKEQGLLKHQINEYTDDEVNSLIMT
FT                   PGFSTKESITEFSGRGVGMDIVRKSIEKVGGSIEVKSKQDEGTTFTIKIPLTLSIVEGM
FT                   KFKVGDSLFTLPISSIRRTFKLTDLNQIITEGNKTELITIYGACIPIIRLHKIYNIQTK
FT                   VTNLMHGNMIIIENEHKAVCIFVDEIIGNQQVVVKPFPVYFNRFNIKNKGLSGCTILGD
FT                   GSISLIIDADSIIEIY"
FT   CDS             562916..563356
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0465"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02275"
FT                   /db_xref="GOA:C9YIS1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS1"
FT                   /protein_id="CBE02275.1"
FT                   /translation="MAKDEIIKQVLTFYVNDVIYGIELENVIETIRFQSITYVPCLPTY
FT                   ISGVINLRGRIIPVINMHIKYNLPKADYNERTCIIITKVDEYQVGIIVDKVVDVIHIEN
FT                   LNLLETTNSNNTNINKDIKEIAKVEDNSILILDIRKFLINSI"
FT   CDS             563392..564195
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="CDR20291_0466"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02276"
FT                   /db_xref="GOA:C9YIS2"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS2"
FT                   /protein_id="CBE02276.1"
FT                   /translation="MIKLTDEEFIVLVNHVKKEYGIDLSKKRALIEGRLYNTMIEKKLS
FT                   SFSQYMNLLFKDKTGNEAINLINRLSTNHTFFMREPQHFEFIQNSILPFWEENNKIRNI
FT                   NIWSAGCSSGEEAYSIAMTLDDYFGYNKELWNIKIIATDISTNSLEKAKRGIYIESNVN
FT                   NVPELWKKKYFIDNKDGTFKICDKIRKSVIFKSFNLMNDFSYQHFDLIFCRNVMIYFDL
FT                   KTREELINKFYNATKKDSFLFVGHAEVINRSSTKYKYVKPAIYKR"
FT   CDS             564253..564831
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0467"
FT                   /product="putative chemotaxis-related protein-glutamate
FT                   methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02278"
FT                   /db_xref="GOA:C9YIS3"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS3"
FT                   /protein_id="CBE02278.1"
FT                   /translation="MVIAIGASVGGTEAILEIIKDLPKSTPGIVVVQHMPAIFTYMYAQ
FT                   RLDKQCIMNVREAKNNDRVEQGNVLIAPGGYQMKLCTDKQGYYVTCEKGERISGHCPSV
FT                   DVLFDSVAEVAGKNSIGIILTGMGYDGANGLLKMKENGLFTIGQDENSCIVYGMPMVAF
FT                   DRGSVMLQLPLGEISNCLIRHINILKQKD"
FT   CDS             564937..565800
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02280"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS4"
FT                   /protein_id="CBE02280.1"
FT                   /translation="MKFFKVDTKAKVLRYVFVLTLTIMAVLAIKHDYKYNNLRKDASIN
FT                   LNSNKEAVTVMSNQSLPKGNTNSKQTLSVSTIGSKTIVKNDEYLESTINMPVITNSNKI
FT                   VERSTNDKIKNDIFEFYNKSYKEAKQYLKDNPDEKNKFVANVDFELKKNTDSALSIKVR
FT                   YYTYSGGAHGFYQDIAYNVDMRTGKFLELMDLFKDNTKYKEVIDEEIKRQIAELEKKDE
FT                   ENIGIYNFKGIKENQNFYLQDENLVVYFDLYDITPYAAGIPEFSINKALISSMLKPEYV
FT                   DLFDLK"
FT   CDS             565867..566856
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0469"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02282"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS5"
FT                   /protein_id="CBE02282.1"
FT                   /translation="MLLLKKDDIKKVFTMRDAIEADKEAFRIYCEGKSVNPLRTNISVP
FT                   SQDASMLFMPGYVEELGCGGIKIVSVFPKNAQKGKPVIPATVLLLDGETGEVSAVLDGT
FT                   YVTQIRTGAASGAAIDVLAKKDSKIGALIGLGGQGEPQLEAMIEARNLDEVRVFSRNRE
FT                   SREKFAEEMNLKLSKYNTKIVAVESSDEAIDNADVIVLATPSKQPVLNGNLVKKGALIS
FT                   AVGSYMPDMQELCPNCLTRASKIFFESTDAVLSESGDILIPLKEGKISKDDFSGDLGNV
FT                   INGTIPGREDDDEIIVFKTVGIGVQDVVTAKRIYDKAKENGIGIDWKW"
FT   CDS             566948..567559
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0470"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02284"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS6"
FT                   /protein_id="CBE02284.1"
FT                   /translation="MKMVKKLILSTIMALVLVLTIGCSNAEEKVKSNFEANLAALEMYK
FT                   YDEKGISDALTEAEYKQIQTYNSKDKVSMIAQLTPLYGKENAEKIYETIVKLIQGVEKT
FT                   VTVESSSKDKITLKVVSKALDTSKVMSEANTLVKSYVTDEKNYDKKEKEVQDDMTKMII
FT                   DLYNKKPTKEVTTMITYTKKDGKWQPPSNIQKLCEGIYTI"
FT   CDS             568002..568799
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0471"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02286"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS7"
FT                   /protein_id="CBE02286.1"
FT                   /translation="MKGVFFMVSRQELKRVSKAQLSGNWGICAISMAVYIALIVLISIV
FT                   GLPFEPLTTIVVAVIAFCVSAGFTCMFLKITKDEKVKIGDIFVSGRIYLRSFGFYLFES
FT                   IIVYIYSFIITIIGAFLSFGVLLTSGAIEYLSSDNVGIGTIISTGITLVLIILVLMLPV
FT                   YILLLYVSQATFLICEDKDNMGVFKSMGASLDMMKGNVLKLFVLNFSFIGWYILSIATL
FT                   GIGLLWLIPYVGVTNCNFYRQLVKENPDVEDILLDKEKSYTMY"
FT   CDS             569004..569363
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0472"
FT                   /product="putative penicillin-binding protein repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02287"
FT                   /db_xref="GOA:C9YIS8"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS8"
FT                   /protein_id="CBE02287.1"
FT                   /translation="MEIKLFDSELKVMEVLWERGESKAGELVKILKEETGWNRNTTYTV
FT                   IKKLVSKGAIERIEPNFVCKALISKEEVQKQETETLINKMFGGSSEKFLSAFINKENLS
FT                   SDEITKLKQIVEKLK"
FT   CDS             569374..570756
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0473"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02289"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIS9"
FT                   /protein_id="CBE02289.1"
FT                   /translation="MFIKLLEMSFTSGVLLLIVIFIRACLFKKLPKKVFVLLWLIVLFK
FT                   LLIPVSLNSGFSIYSIIESTFDVELGNTSTENYTLKKASDSTGKNNSDEFEIMSNIENI
FT                   MMLEMLGILSFIVTIMFSILLCFRYFKIINLFKTSIHIKNHEFIKKWMCKNSRFRRFIV
FT                   CISEFTRTPLTSGILKPRIILPKQMNYANNQTLDFVLTHEMVHINSFDNLLKLFMLVAL
FT                   VVHWFNPLVWVMFFLLNKDIEFSCDEKVMSILGEEYRADYATTLISLAEENNPFSMTIC
FT                   SGFGKTKIEKRIVNIMKFKKSTYVTFLVSTVLVCGTGLVFATENKEINEVESFGLTKNE
FT                   QSDKSGFSISSKSTDLYSPKVESDILVSKAKSDGETHFSTAKVSVIEFREHEESSMSKV
FT                   TNSENSEETYVNKSSNSKDVLYTDSGEVSIEQSNYNDNRFVISRKGNLLAVNKEQYRTW
FT                   IE"
FT   CDS             570972..571382
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0474"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02291"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT0"
FT                   /protein_id="CBE02291.1"
FT                   /translation="MKIKKSLISAMMVSAMVLGGTGAVFANGNDSSNIALPKLESLIKS
FT                   GITDPTELEKYGVEHYTYEEYAKHIQELKDYAKDPNAVKDVSQKDLEETIKKMEQELEK
FT                   IKTEGLKIMKPITIENEDGSQISIAYNYAAID"
FT   CDS             572575..573231
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0475"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02293"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT1"
FT                   /protein_id="CBE02293.1"
FT                   /translation="MKKGDFIWSGVLICIIAVLAIPSSREVFMEATGAHPYIGGFLKFA
FT                   VLATMGDLLGARILYKDWKIPVGVFYRAIVWGIIGVVTTYGMSIYSSGVGQAQVDGMLP
FT                   FEGIAFANALFKSATMNILMSPTVFLFHKVMDCFIDKKYEVGKGIKVKLKDVVNIVDWN
FT                   AYLGFSVLKTIPFFWIPCHTIVFLFPAEYRVIASAFASIALGLILALANKSKVAV"
FT   CDS             complement(573701..574972)
FT                   /transl_table=11
FT                   /gene="sleC"
FT                   /locus_tag="CDR20291_0476"
FT                   /product="putative spore cortex-lytic enzyme pre-pro-form
FT                   (putative spore peptidoglycan hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02295"
FT                   /db_xref="GOA:C9YIT2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT2"
FT                   /protein_id="CBE02295.1"
FT                   /translation="MQDGFLTVSIIDATNNRPIQNAVVNIYSMSNGSQSSSTLYQNLRS
FT                   NESGQVTGLVLPAPDVDYSLQPSDVRPYSQYIVEAIADGYETVVIEGTQLLATIVARQG
FT                   VPMSPRTRSKRSFSRQSELIFDIGEHTLYGTYPPKIPESNLKPLPPPTGFVVLDNPVVP
FT                   EFIVVHDGLPEDSSAPNYWIPFKEYIKNIASSEIYSTWPEQTIYANVIAIISFTLNRVF
FT                   TEWYRNKGYNFTITSTTAYDHKFINNRNLFEPINVVVDAIFNTFIKRPPTSRQPLLAQY
FT                   CDGQKSQCPDQMTQWGSKDLGDQGYDYESILRYFYGDEIVFERAPIVSGVPVSFPGTTL
FT                   QVGSSGQYVRTIQNQLNAISNSYPAVPKVIEDGIYGADTENAVKIFQGIFGLPQSGVVD
FT                   FKTWYEISRVYVATTRIASLNPLI"
FT   CDS             575217..575933
FT                   /transl_table=11
FT                   /gene="sleB"
FT                   /locus_tag="CDR20291_0477"
FT                   /product="putative spore-cortex-lytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02296"
FT                   /db_xref="GOA:C9YIT3"
FT                   /db_xref="InterPro:IPR023596"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT3"
FT                   /protein_id="CBE02296.1"
FT                   /translation="MKLDLFLLAIVPILIGMFWIRSKDRYCREPLIHLIKFFLIGAFLS
FT                   VIIILLENLLMKFNVFEGYSELIYVSFVVAGLVEEGVKALILIPALIKEKHFTEKLDGI
FT                   IYSVFLALGFATIENMVYIFSESRNLALQVGINRAVISIPAHVMFAITMGYYISKYKFE
FT                   GNKNKRREYLFMAVLIPILLHGVFDFILMIEYRWAIILLIVYVIILWKINLDKLEKYMN
FT                   HSKKVFFGNLRKKKKK"
FT   CDS             576012..577322
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0478"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02298"
FT                   /db_xref="GOA:C9YIT4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT4"
FT                   /protein_id="CBE02298.1"
FT                   /translation="MTELPKEFLEDIEEILKDEYDDFIKSYEESKTTGLRINTLKIDKK
FT                   KLFDLELFDLNQIPWAEEGFYYDDKIDRPGRNPLHEAGAYYLQEPSAMSVIPKADIKEG
FT                   EKVLDMCAAPGGKSTYILSKLNDTGLLVSNEINASRIKALGENLERFGARNCIITNTDS
FT                   NSLRKTFNGYFDKVIIDAPCSGQGMFRKDEVAISDWSYAKVVECQSIQKEIIRDGYKML
FT                   KKDGILIYSTCTFSREENEHVINEFISEYPHAELIEMERLWPHKIKGEGHFVAKIKKLE
FT                   EEECNVKELKIKNLDKEIKDYREFEKKFLKVDFYSNKKNKFYLRGENLYLLPEIYPDTK
FT                   KLKVLRYGLHLGVLKKNRFEPSHALSHYLKVEDVKNVENFSVQSESILKYLKGDVVNSN
FT                   DSRGWVLVSVEGIPLGWGKESSGVIKNHYPKGLRKVF"
FT   CDS             577422..577958
FT                   /transl_table=11
FT                   /gene="sip2"
FT                   /locus_tag="CDR20291_0479"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02300"
FT                   /db_xref="GOA:C9YIT5"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT5"
FT                   /protein_id="CBE02300.1"
FT                   /translation="MGEAVKKEVVEWIKVIVIALVLAFAITRFIVPTIVKGESMYPTLV
FT                   ERDYLIVNRIAYKVGEPKYKDIIVFKTDLTEENGKKKDLVKRVIGVPGDHVKIQDSKVY
FT                   VNDKLLDETSYIHNNRTDGDIDIVVPEGKLFAMGDNREKSLDSRYDEVGLVDEHTILGK
FT                   VLVRLYPFSKIGTID"
FT   CDS             578124..578660
FT                   /transl_table=11
FT                   /gene="sip2"
FT                   /locus_tag="CDR20291_0480"
FT                   /product="singal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02302"
FT                   /db_xref="GOA:C9YIT6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT6"
FT                   /protein_id="CBE02302.1"
FT                   /translation="MNETIKEEIVEWIKIIITALFFAFIITRFIKPTLVNGESMYPTLK
FT                   SHDYLVANRMTYKLSEPKCGDIMIFKTDLLQENGRKKELVKRVIGVPGDHLKIKDSKVY
FT                   INGKLLNEVSYIHDNYTEGDIDMVIPKGKVFAMGDNREVSLDSRYKEVGLVDEENIKGK
FT                   VILRVFPFTDIGIFE"
FT   CDS             578670..579425
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0481"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02304"
FT                   /db_xref="GOA:C9YIT7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT7"
FT                   /protein_id="CBE02304.1"
FT                   /translation="MAVGIASLLFNIEEALNICESIKQITHLEIGIDNISECSELCKYK
FT                   ERISKLGLSIGIHLPMELNTCENIEYIRNSWINFIEKIEFELKGFDIRYFNLHLGYVMT
FT                   NRVRKNRDKYLGNSVDFLDKLNTNSYVCIENTYSKGGDFSNIGNISYDFEYIFKRIKNS
FT                   KICFCYDTGHCLIDEDAYVKNLKDKIRLIHLSDNDGINDTHVGIGRGILSEEGIKEVLT
FT                   LDAEYLVLEINYEDIEDTISKLNNIVREG"
FT   CDS             579499..581166
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0482"
FT                   /product="putative phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02305"
FT                   /db_xref="GOA:C9YIT8"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT8"
FT                   /protein_id="CBE02305.1"
FT                   /translation="MKKINLKIEGKDKEYSLEENSPGIRLGDIAKEFCDEHKGYITLAV
FT                   VDNKLKELNCRVKKDCEINFLDTTNEDGERVYFRVMSFIFVMACREIFWDSRVTIEHSL
FT                   SDGLYCEVHIDRKLKEADVENIKNKMKEIVNNDYVIEKIEVTRNEAISIFENNEMYEKA
FT                   ELLKYKEYDSAKVYKCRNYIDHFYGYMLPSTGYIKSFDIKLYNGGVIILGPSEEDKTLP
FT                   MKFVPQPKLSSVYYEAEEWSRLMGIDKVVSLNKIIENNEYGDIIRTFEALHEKKLSQIA
FT                   DMIKDGNKRVILIAAPSSSGKTSFAHRLSIHLRVNNLNPISISLDDYFIDRKHTPLDEY
FT                   GNYDFESIYAIDLEKFNLDLKKLLAGEEIDDIRFNFKEGKREYTGKKIKIDSNQPIILE
FT                   GIHGLNPILTSSIPDEDKFKIYISALTQINLDDHNRIPTADLRMIRRIVRDYNFRGYSA
FT                   DNTILQWASVRRGEKKNIFPYQEEADAIFNSACVYELAVLKRFAKPLLEEIKEDNPAHI
FT                   EATRLLKFLQYFVELDDTSDIPGISILREFIGGSKIVD"
FT   CDS             581744..582673
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="CDR20291_0483"
FT                   /product="probable glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02307"
FT                   /db_xref="GOA:C9YIT9"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIT9"
FT                   /protein_id="CBE02307.1"
FT                   /translation="MNTLDETLLKEIISSNKKYTNYGQVASYIPELKNARRNDLGICII
FT                   DSENNLYSAGNCSTKFTIQSISKPIVLAMALMDNDWEDVFSNVGMEPSGDPFNSIMKLE
FT                   INDTKKPCNPMINAGAIVTTSLINGSCLEEKEERMLSFFRKLAKNDNIGINYDVYKSEK
FT                   MTGDRNRAMAYLLKSDGFIRGNVEDVLDLYFKQCSIEIDSVDLARIGINLANYGVDIEN
FT                   GEHLMSEMVSRIVKTFMMTCGMYDASGEFAIKVGIPAKSGVGGGIMASVPGRMGIGVYG
FT                   PALDKKGNSVAGVKVLEELSNKLKLNIF"
FT   CDS             582771..583334
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02308"
FT                   /db_xref="GOA:C9YIU0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU0"
FT                   /protein_id="CBE02308.1"
FT                   /translation="MKEVLVLRDLECIKAIAHPRRIDILKAFDKSPLSAKQLSQLLEEP
FT                   HAKINYHIKMLYKVGILELVEEKIKSGIVEKYYYPSAKNVVIGNRILNFSLDNGEEKEE
FT                   LYISKFENMSEVFYKAAEEDVLENENIVDYHDISLTHDELVELSDTMKSKIDEILNKRQ
FT                   HNVEGSKYDIAMVIVPTLEEECPS"
FT   CDS             583822..584658
FT                   /transl_table=11
FT                   /gene="nfo"
FT                   /locus_tag="CDR20291_0485"
FT                   /product="endonuclease IV"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02310"
FT                   /db_xref="GOA:C9YIU1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU1"
FT                   /protein_id="CBE02310.1"
FT                   /translation="MIKLGTHLSIAKGFANAAETAVYIGANTFQFFSRNPRGGNAKEFD
FT                   EKDIIKFQEIRKENNFAPLLAHAPYTMNLGGTKDDVYEFATRVIDEDIRRMDSLGIEYM
FT                   CFHPGSHIGGGVDFGIDRIVKGLNNAIKGDENITILLETMSGKGTEIGFKFEQLKSIID
FT                   KIEHKEKIGVCLDTCHIFSAGYDIVNDLDGVLEEFDKVIGIERLKTVHLNDSMMPFGDK
FT                   KDRHAPIGEGKIGLKALIDFMEHPSLKHLPFFLETPFDDEGHKRELKMIKEILSSK"
FT   CDS             584910..585905
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0486"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02311"
FT                   /db_xref="GOA:C9YIU2"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU2"
FT                   /protein_id="CBE02311.1"
FT                   /translation="MRNLGNTNMKIKRVGFGGIPIQRITQDDTNLVINELEKQGINFID
FT                   SARGYTISEEAIGIAIEGKRNKFFLATKSMSRDYDSMKRDVEISLNNFKTDFIDLYQFH
FT                   NVKEEEYDNLFKDKMAYSALLEAKEQGKIKHIGITSHNLNTIEKAIEDGKFDTIQFPYN
FT                   IVEGQADEVFKKAHEKGIGIIVMKPLAGGALDNATLAIKYILSKDYIDVVIPGMESVEQ
FT                   VRQNVAVLENLVLDEKDNKEIEEIRNSLGKKFCRRCEYCMPCAVGINIPLSFLCEGYYT
FT                   RYGLKEWAKEKYEVMDVKPTECIDCGLCESRCPYELPIREMLKTVVEKLG"
FT   CDS             complement(586162..586578)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0487"
FT                   /product="putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02313"
FT                   /db_xref="GOA:C9YIU3"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU3"
FT                   /protein_id="CBE02313.1"
FT                   /translation="MVKNLIKITIPGRPISKSNFKLHNINGQAWMPSKGKYSKYLAYEN
FT                   MIAGFINQQYQGETVEENLITVLKLFFPNKRMGDLHNYPKSICDGIEKSGIIKNDKQLK
FT                   PVFLFDFIDKDNPRVEIELYPVSKYDISYNIFEK"
FT   CDS             587566..588480
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0488"
FT                   /product="putative iron-sulfur cluster protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02315"
FT                   /db_xref="GOA:C9YIU4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU4"
FT                   /protein_id="CBE02315.1"
FT                   /translation="MDNKELKAFCNLIGLNCVGVAGVDKYDNLEKILKDRQQKGYLTGM
FT                   EEPIIENRINPRHIMKDANSIIVCAFPYHINRQEKNKNSNLSKYCHGKDYHIVVKDFLQ
FT                   QICDYISKTVTDFKYKLFVDNGPLVDRYLAYLSGIGYFGINNNIITDEYGSYVFIGYIV
FT                   NNYKFEEDKPLEKSCFKCGKCVKYCPGNAILGNYDMNPKKCLSYITQKKGDLSEKEKVV
FT                   LKNGKKVFGCDICQEVCPHNVEMPTTHILEFKENIIDYLDYDEIQNISNKEFKRRYGDR
FT                   AFSWRGRNIIKRNMEIILDKYDD"
FT   CDS             588586..590823
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0489"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02317"
FT                   /db_xref="GOA:C9YIU5"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU5"
FT                   /protein_id="CBE02317.1"
FT                   /translation="MKYNNTSEINPLDYILGQERAVEAMELGLKINNPAYNIYIAGEPG
FT                   TGKSTYALKVLNEYASKKNTHKDWCYIYNFENPREPIIVELEKGFGRELKKDMEKLIES
FT                   LLEDFKNAFESENFEIEKNRLLDEYEIEKDMLLKQIKKYGEEKGFKLKQSKMGIVFIPL
FT                   KEEEDESDKSDEEFYKAKRELENMAIQVVYKIRNLEEIAEKAVLELEEEIAKLVVEPHI
FT                   KRLCEKYENYDKIQTYLENIKKDIIEYMYLFYLDEEELKDKYDKEHFIKYKINLFVDNE
FT                   SSKNKESAPVVVEINPSPANLFGKAEYDYANGNIKTDFTKLLSGAFHRANGGYLVLYAD
FT                   QLLKYTMSWEILKKTLQTKKVILETQTAIKPENMPLDVKLVLIGSHYIYDILYRYDEDF
FT                   EKYFKVFVDFDSEMDKNEDNEEGIARFIAYQCDKNNLRHFTKSAVEEVIKFSTRLSGDL
FT                   EKLSTKFNKIMEVVIEGSAYAEFRNSEYTEQCDVKKAISEKRKRINRVETHMDESIENG
FT                   FTLIETEGRKVGVINGLSVLSTGEYSFGRASRITATTSPGSKGIVNIEREVNMSGSIHN
FT                   KGVLILGGYLSENFAQDLLLSLNAYVCFEQNYGGIDGDSASSAELYVLLSSLSGVSIKQ
FT                   NIAVTGSINQKGDIQVVGGISEKIEGFYSICKTKGLNGEQGVIIPRKNQRNLVLSDEVN
FT                   DAVRDGKFKIYTVERVEEAIEILTDVKFEEIKKLVKEKLISFSKIQTVSKE"
FT   CDS             591467..592072
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="CDR20291_0490"
FT                   /product="endonuclease iii"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02318"
FT                   /db_xref="GOA:C9YIU6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU6"
FT                   /protein_id="CBE02318.1"
FT                   /translation="MEKLYPDAKCELNYGTAFELLIATILSAQCTDVRVNKVTSELFKK
FT                   YNTARDFANLSIEEISKEIKSCGLYKSKSQKIKDTSEQLCELYDGEVPDSLEKLIKLPG
FT                   VGRKTAGVVLSNAFNHPAIAVDTHVFRVSNRIGIVDEPNPQKTEFALMEAIPKERWSHS
FT                   HHVLIFHGRRMCKARNPECASCPIKEDCNYYKELNETK"
FT   CDS             592266..592736
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0491"
FT                   /product="putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02320"
FT                   /db_xref="GOA:C9YIU7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU7"
FT                   /protein_id="CBE02320.1"
FT                   /translation="MSLNIVLVEPEIPQNTGNIIRTCAATGSTLHLVKPLGFSLDDKHL
FT                   KRCGLDYWDIADIQYYDSFEELQEKYPNSKYFFSTTKAKQSHSDVKYEENCFIVFGKET
FT                   KGLPEPLLKANMDTCIRVPMLDVEKARSLNLSNSVAIVVYEALRQIGYPNMR"
FT   CDS             592772..593620
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02322"
FT                   /db_xref="GOA:C9YIU8"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU8"
FT                   /protein_id="CBE02322.1"
FT                   /translation="MKNLKIICDSLSDVPKDLLDKYDIDIVSLTVILEEREYKDRIDIS
FT                   GDEFYKRLREENVYPKTSQATYAQFKEIFEKYTNEDREILYIAGSATATGTYQSAVMAK
FT                   NDVDGKIYTYDSNLLCMGTGLLVIKAGELASEGKSVDEILPVLDELKEKAFVIFSVDTL
FT                   EYLQKGGRISSTKAAIGSILNIKPILEIRDGLVSQISQVRGKKNVISKMMELIKSNCGD
FT                   DLSDQIVYIGYSDDFKEKEQLSKVMQDELRPKEIRFFQIGVCIGAHAGPGVTGIICLKN
FT                   K"
FT   CDS             593976..594980
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0493"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02324"
FT                   /db_xref="GOA:C9YIU9"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIU9"
FT                   /protein_id="CBE02324.1"
FT                   /translation="MRFKRILILMLTVAMIAGMLVGCANNPSNNPSSSKDNKSDISDKS
FT                   NSKKSVSMILDIEGTNNEAMNNAALLALNNAQKKLNIDTNKVESDDSSTFSNSIDILCN
FT                   DNYDLIIAVGARFAKPLEMVAKKYPKQQFAIIDYEYDKQPSNITSISYEDNKSGYLAGL
FT                   IAGKMTESDKVGFIGGIKSSSRDKFESGFREGVKFSNSSIKDISVEYADVFKDSKSVES
FT                   IAKKMMDNGVDIIFSTTEDDSKAVIDAVRAKNKKVIATNKDQHELAPENVISSIVKDFE
FT                   NPTYNLIQSFVKGNYKGGKVIENTVKSGSTGLAQNSSQNIPPDVLEYVNKNNK"
FT   CDS             595096..596217
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0494"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02325"
FT                   /db_xref="GOA:C9YIV0"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV0"
FT                   /protein_id="CBE02325.1"
FT                   /translation="MNFVKIKRILMACFVVVFTIFILAICNFDFGFDKVNKNNSNIDSA
FT                   KSKQSESKSVPTSAEKDKLNSKSKNEEDDTEDDSYVRKTIGVLLDTENLNNESYNNNVL
FT                   SALKRADEDFDVRIKLEKPKTSKSFKESIEKLHKYEPDLIIAVGARFAEPIKEAATKYP
FT                   KQQFAIVDYTYKVQPANVISVSFQDNVTGYLAGLIAGKMTDTGKVGFIGGVEGSSRDKY
FT                   ESGFRKGLKTSNKDAELLVKYSNIFENPESARTIAKEMRDSDRDVVFSATEDDSKRAIQ
FT                   VARENGGKVIAINKDQYDMAPDNVISSIIKDVEQPVYELIKNVAKDGFKGSKVMEFKIK
FT                   DGELGLTSKSSRNIPPDVLEYIKKEYNKVKDTY"
FT   CDS             596640..597401
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02327"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV1"
FT                   /protein_id="CBE02327.1"
FT                   /translation="MEFTREPFILDDDLCLALVDKRISYLMENELKLRNIEIIKTIECK
FT                   ELYESIKYHPDICICNLGKGDIIVAPNVYNQYKELLSRYKFNIIKGEANLLNRYPYDIP
FT                   YNIAIVGDYAIHNFKYTDKAILDYIENNKLKKINIEQGYSKCSICIVDRTSIITSDKGI
FT                   WKSMKNTEIECLLIEKGHINLFEMNYGFIGGCTGLISKDKLAFCGDVKKHPDYERIKSF
FT                   VESKNKEIVTLSCENLLDIGSIVPLMTRKER"
FT   CDS             597431..598222
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02329"
FT                   /db_xref="InterPro:IPR014199"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV2"
FT                   /protein_id="CBE02329.1"
FT                   /translation="MKFLRNNNVNDRLIYTNDIVEVVIDSAKQEVLNKKILNGTKAEQR
FT                   ALNIDEISTEITSMIISIMKEKLLKEYILKCYGRTYPEDKNNIYIYSLNIFAKKEIFMR
FT                   ETVFTRVRNYIEENDFINVEGFIRFRMREFMKYISAIGDIAVEEYLIKKDQDEFIRVLK
FT                   YFIDTQEEKIDLLKVHIMEDNTFVLYDKNGNKIDSIDDEEIINMVIRENLNYEDFLIST
FT                   LLTLCPKKIEILDLLNNNCSKEIIDTVEAIFENKVSIIMEN"
FT   CDS             598402..599004
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0497"
FT                   /product="putative membrane protin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02331"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV3"
FT                   /protein_id="CBE02331.1"
FT                   /translation="MDNLIRILILAVIGGFIGYVTNVVAIRLIFRPIEPIKIPILNIEI
FT                   VGLIPKRRAEIAANVGEIIQEEFLSMDEILANIITDEDKEEVVRYIKARVKIIIHEKVS
FT                   FIPSGIKNMIQDYLGEIIESEVKQSIDELSKNIINKANERIDIQKMVEDKINELDLYEL
FT                   EEIIIRIAKKELKHIEFLGLVLGFLIGIAQGLITMFI"
FT   CDS             599774..601786
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="CDR20291_0498"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02332"
FT                   /db_xref="GOA:C9YIV4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV4"
FT                   /protein_id="CBE02332.1"
FT                   /translation="MEPRINIVPNIFGAIFYYKKSKNYFNKEEKTMIKVALKDGSIKEF
FT                   ENAISVMDVAKSISEGLARNVVAASVNGEVVGLDHIIDTDCDLNLFKFEDKEGKEVFRH
FT                   TSAHILAQAIKRLYPEAKLAIGPSIENGFYYDIDLDHRLVPEDLEKIEAEMKKIAKEDL
FT                   KIERFELPRNEALELMKEQGEDYKVELISDLPESEIISFYKQGDFTDLCRGPHLPSTKK
FT                   VKAVKLQSVAGAYWRGDENNKMLQRIYGTSFEKNKDLEEYLHLLEEAKKRDHRKLGKEL
FT                   GLFMIPEEGPGFPMFLPKGMELKNELLKFWREIHRKAGYIEIESPIILNRKLWETSGHW
FT                   YHYKENMYTVKIDDEDYAIKPMNCPGGLIYYNSQLHSYRDFPMRVAELGRVHRHELSGA
FT                   LQGLMRVRAFTQDDSHIFMLPEQIKDEIKGVANLIDGIYKTFGFEYNLELSTRPENSMG
FT                   SDEEWEAAENGLREALEELGLPYTINEGDGAFYGPKIDFHLKDCLGRTWQCGTIQLDMQ
FT                   LPRQFDNTYIGQDGEKHRPVMIHRVAFGSIERFIGILIEHYAGKFPVWLSPTQVKILPI
FT                   SDKFMDYANEVKKELFDKGIRVELDDRAEKIGFKIREAQLEKVPYMLIVGEKEVADNNV
FT                   SVRSRDKGEIGSIKLDEFIASISKEIESRESIIQD"
FT   CDS             join(602554..602985,605000..605545)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0499"
FT                   /product="putative uncharacterized protein (pseudogene)"
FT   CDS             603722..604840
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0500"
FT                   /product="transposase-like protein b"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02335"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV5"
FT                   /protein_id="CBE02335.1"
FT                   /translation="MVVVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIEVYK
FT                   NAKETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALRDLDNAYKKFFKEKAGFPKFKS
FT                   KKINRFSYKTNFTNGNIMYCGQHIKLPKLGMVKIRDKQVPKGRILNATISKEPSGRYYV
FT                   SLCCTDVDIEAFENTNNHIGLDLGIKEFCISSCGDFIENPKYLKKSLNKLAKLQRELSR
FT                   KTIGSLNRNKARLKVARLQEHIANQRNDFLQKLSTKLIKENDIICIEDLQVKNMIRNRK
FT                   LSRLISDVSWSEFIRQLEYKANWYGRQIVKVGKFFASSQICNKCGYKNEEVKNLNIREW
FT                   ICPSCNETHDRDINASINILKEGLRLITIQNK"
FT   CDS             complement(605838..606875)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0501"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02337"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV6"
FT                   /protein_id="CBE02337.1"
FT                   /translation="MNKKLIKAKIFIWSILAISLSIVFISLLIGTIISHSFNFPFNTLN
FT                   PKYNYDNYIVAKNESFSDKINDINVDWISGEVRIKRSDSNKIKLIQKIPSNFSKKKLAK
FT                   IMVDGNSLSIYDNSTKKFFIGINLPKPTILELYLPNKLYDKITLYTTSADIYSTYIRSN
FT                   TVEANTISGAIGLSGNINKINLDTTSGHIDITKLNSKNATLKSTSGEIQLSGKIDVLNL
FT                   ETTNGNINLKDIYNKNLTCSSVSGKMNLSGVFSDIKAESTSSNIKINSSKMLSSLYCET
FT                   TSANVDLSIPDNPGFTLNFDKVSGVLDSDFELNRHSDLYTYKNGITNLYLSTTNGNLTI
FT                   IKNNH"
FT   CDS             complement(606868..607554)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0502"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02339"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV7"
FT                   /protein_id="CBE02339.1"
FT                   /translation="MLDKIRTYIDSSFTGVNETKKVKELKDELFENLKEKYNDQIQDGK
FT                   TEQEAYNSVISGIGDLSELIESVKEPYSLPSELIEEKKKRALRASIAVALFIISPFLFV
FT                   VSVVSFGIEPTIAILLMLILIALGVGLLVYNQMTRTNYALYNDNLSNKFKEFEDFEENY
FT                   NHINPVYKSFMNAYWIIVVSIYLITSILFNIWSFSWILFIIGAAGVNIVKGIIQLKGYK
FT                   EEDKYE"
FT   CDS             608247..609587
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0503"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02341"
FT                   /db_xref="GOA:C9YIV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV8"
FT                   /protein_id="CBE02341.1"
FT                   /translation="MIKSSLFWNIFIAISFMIEWFLCKKMLDYTSEKRISNKKINFCMV
FT                   GIIVFADIIYFFDVPPNIRVIISMIITIAFYKISYDVGFIKSVLISLIYWMLLIATDAL
FT                   SISLTVWLNSINDMSSMGTGDIYRIESIILGKILLIVSLFLYRALKIKLNIEINKRTLF
FT                   YIVIPIVANIASFFVIFEYIFNPGSGSLIHNFQFVMISVVLLISSITLVLIAKKLQQYN
FT                   TLVVENNMIKNTLKYENEYYEDIEKKYLKTRLLSHDMKNHILCINAMIKKGIDVTSYLN
FT                   NLQVEIQSNDLLFNTGNFILDAILSEKKEVCDKNDIELKIGINFSCCEAVELVDICHIF
FT                   SNILDNAIEACNKIDSGNRVICVKGDVMQNFYLIRVENTKMNKIITKNGDILTDKKGSL
FT                   HGLGIKSVKNSVNKYGGNVVIEYDDKKFVVKIAIPLRNVKKAVNHVI"
FT   CDS             complement(610265..610888)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02342"
FT                   /db_xref="GOA:C9YIV9"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIV9"
FT                   /protein_id="CBE02342.1"
FT                   /translation="MENKLYKNSKYSARGVIKMSYMPTLEQAWEILRKYNKEEFHIRHA
FT                   QIVSGVMRYYAKEYDPERVDFWEIVGLLHDLDFEMYPDEHCVKQRELMTELDLDKSIID
FT                   STISHGYGLTGSDVKPEQFMEKVLFAVDELTGLIGAVAIMRPSKSVSDLELKSVKKKFK
FT                   DKSFAAGCSRDVIRSGAEMLGWELDKLIQTTIEAMRSLIPEMAI"
FT   CDS             complement(610995..612245)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0505"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02344"
FT                   /db_xref="GOA:C9YIW0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW0"
FT                   /protein_id="CBE02344.1"
FT                   /translation="MVKSSNTFNKNFNLMILGQIISLFGASILKFALSLYILDITGKAE
FT                   IFATILAVSSIPIIVFSPIGGAIADIFNRRNLMVIFDFSSSLTVLILAVFLFNNNGSIL
FT                   LVGIIMTILSVISTMYQPTVQSSTPLLVDNEHLMNANGIVAGVASLTNIAGPVLGGVLY
FT                   GVIGINAIIVISCVSFFLSAIMEIFIQIPFIKQEQNSNIIKTIFTDIKDGIVHICKENR
FT                   FILKILFLAIAINLFLSSMLIVGIPYIVKITMGASNFLYGLAEGAISFSSLVAAVSIGI
FT                   FSKHLKITNLHISFIICAVMFIPMAVSVYPFILNTGFPVPFLIFIVSSMLIFFTTTLIS
FT                   IYVITVTQLKTPNELLGKVMSILFAGTAIAMPLGQVMYGKLFDLLSDRVYIIILGVGFI
FT                   TLLIAFVSKITLRNENL"
FT   CDS             complement(612537..613115)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0506"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02346"
FT                   /db_xref="GOA:C9YIW1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW1"
FT                   /protein_id="CBE02346.1"
FT                   /translation="MAKSFTEIEKDNIRKRLISECEINWSKYGYKKTNIDELCSKSGIA
FT                   KGSFYTFFDSKEKLFFEVLNGIQNRLISSVDEILSNMPPKEGFAKSLKMLYRLYDKNPF
FT                   LYSPNNPDFISLINKLPQDMFLQLESNNIQSFYDLIKRHNLKLKIEKEKAFGVCNSLLS
FT                   SLLVKENIEYNYIEVFDFMVDNLVEHILE"
FT   CDS             613454..614914
FT                   /transl_table=11
FT                   /gene="gapN"
FT                   /locus_tag="CDR20291_0507"
FT                   /product="NADP-dependent glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02347"
FT                   /db_xref="GOA:C9YIW2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW2"
FT                   /protein_id="CBE02347.1"
FT                   /translation="MFNELKTKENVYKNLINGKWVESNSRKPIEIYSPIDNSLVGKVQS
FT                   MTKHEVDEVIKNTKESIKVWAEMPVYKRANIFHKAADLLLENIDEIANILVLEIAKDIK
FT                   SARAEVERTADFLRYTADVGKNMEGEAISGDNFPGGTRNKMSYVSRVPLGTVLAISPFN
FT                   YPVNLSMSKIAPALIGGNAVVLKPATQGAISALHVVEIMRKAGIPDGVLNTITGRGSEI
FT                   GDYVVTHKGINFINFTGSTEVGQHISKISGMVPLLLELGGKDAAIVLEDADLDFAAKNI
FT                   VSGAYSYSGQRCTAVKRILVQESVADKLVGKIKPLVEKLTIGNPMDEVVITPLIDNKAT
FT                   DFVQGLVDDALHKGAKLITGNVRKNNLFYPTLLDNVNVDMKIAWEEPFGPVLPIIRVKD
FT                   INQAIEIANQSEYGLQSSVFTSDIDRAFYIADKLEVGTVQINNKTERGPDHFPFLGVKA
FT                   SGMGTQGVKYSIEAMTRPKAVVVNVREL"
FT   CDS             615288..615893
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0508"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02349"
FT                   /db_xref="GOA:C9YIW3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW3"
FT                   /protein_id="CBE02349.1"
FT                   /translation="MPKGIVLTPEQQAERREKIVAVALSLMAENGFQKTSMREIAVLAN
FT                   MGKSSLYDFFKTKDEIVVYAVEKEIEKTIQQVHRIIDGEPSPQQCLRKIMLNHLRFPEQ
FT                   YRTVLMWLNTESDYLEEEYRKRLKDARYAYQDIIKSVIDNGVTTGIFRKTDTALVTRLL
FT                   INSMLSISYTSRPSDSSEKMLDETMNIFLHGIMNDGGE"
FT   CDS             615890..618463
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0509"
FT                   /product="putative PEP-utilising kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02351"
FT                   /db_xref="GOA:C9YIW4"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW4"
FT                   /protein_id="CBE02351.1"
FT                   /translation="MIMIYYVLPLEHKQATIEIVGGKGMSLSKLLTAGIPVPDGFHVTT
FT                   ASYQIFVETNHIQSRINKLLDGIDSNNTNQLEDVSKKIGELFHNGEMPQEVSDAIKTAY
FT                   AGLGNISVAVRSSATAEDLPDASFAGQQETYLNIQGEDKVIDAVKRCWASLWTARAIAY
FT                   RVKNNIKHEIVALAVVVQKLAFSDSSGIMFTLNPINGRRSEMIINAAWGLGEAVVSSLV
FT                   TPDTIVVDKDSERIISYEVANKEIMTVRTSEGTEETMVPERLRKKYALTRNQVMQLIQL
FT                   GKKIEKYYQMPMDVEWALEKDKLYIVQARPITVLPPEWVLPEQDVVYTKGSLAEHLPNP
FT                   VTPLFATLGLEIVNRASELLWIDMFGKSAKKLLPKNGAYTVINGYVYLSAKSKPLLIAI
FT                   KSLSPRSLRRTLMNSVARWETARKGYEDAIKQWEEKPLHTMNAHQIMDGIQTIFYAACI
FT                   YFTRIQLTLPAASISETLFTKLFQGAVRRAGITDTSVFLLGFDTIALQSEKELWGLSEW
FT                   VKQNNSINLYLQNSPAIKIAEDFMSSVMPVGVSQEVWIEWKNRINKYFKEFGRTAYEFD
FT                   FAYSTPQETLTPTFESVKTFVEGKGESPFLRQTTFEKRRKHAEEEILQHIGGLRKKLFF
FT                   KLLHWAQETSPMRENAIYLMGMGHPLIRCMFQEISERFIRGGAISHLDDIYWLTKSELE
FT                   VLIEQLDKNKSLSDMNGIIPVRKAELKKYMGYVSPSKLPEKNKKTISQAPQKQKDGKIV
FT                   LTGIGTSTGVVTAPACVLNSPADFESFQPGSVLVAVTTTPAWTPLFSSASAIVTDIGGP
FT                   LSHSSIVAREYGIPAVMATHIATRTIKSGQMITVDGLAGTVTFDE"
FT   CDS             complement(618722..619213)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0510"
FT                   /product="putative signaling protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02352"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW5"
FT                   /protein_id="CBE02352.1"
FT                   /translation="MSHYHFSSKNFIKKYDKIAKKYDIPSHLIEIEITETIVFEDVKVF
FT                   SEIINEIHKNDFKCSIDDFGSGYSSINMLKGIYVDTLKLDRAFFQSEDLDSQRERNIIV
FT                   SIIELAKKLKMTTVAERIETSFQKDFLQEINCDMLQGYVFSRPLQIKDFEKLMFQNSSN
FT                   "
FT   CDS             619729..620004
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02354"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW6"
FT                   /protein_id="CBE02354.1"
FT                   /translation="MSLFVGGWSKFRAVEEEDLKVFNEAIGMLKGVDYEPLIVATQVVA
FT                   GTNFKFICNATSVTNPPHDYLAEIIVFKPLPCDEHNATITSINIIK"
FT   CDS             620024..620311
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02356"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW7"
FT                   /protein_id="CBE02356.1"
FT                   /translation="MRLNVTKQNTIEVENSRKEDVYFVIVDNVFFERQGDVFNSITNNN
FT                   LNNYDVKILPTDNVFLELKITSTKDLEPVFIVVEDRQYNHGSIMFKPVLV"
FT   CDS             join(620784..621215,623039..625162)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02358"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW8"
FT                   /protein_id="CBE02358.1"
FT                   /translation="MPENNNQLLEEITLLLNEGKVAINKAENQNLILILGGTGCGKSTA
FT                   INYLAGCVMMEVEDEDTGISYIDCLDPVAEIGSGAVSQTLYPNIVNMRKPIEGMDAKLC
FT                   DTAGFSDNRGVAHDISAAVSLGEVFKNSASICAVIVLIKKMQNSVKQEPCDFSHGRFRP
FT                   EADILDSRLTKVLDLFQQLNMCLHKDNFRGSITFFISKSFLGRTEKQIYNVIKRKYEQL
FT                   CENLDSNIEEKAWLFEELLKDNGKNIHLCKPLESDEREGLLKQVLELDEVKDKTSAFQY
FT                   PISADARLVLDTLIKEIQNNIVSSLEDYVKAYTEDFISIIGSITMIQEIAKYDEVVKVF
FT                   KNWLESTTTLTIERFINVLAKQSGLFLQDSCMELQNKIKGNLDIIDALSKYTEHGTGEI
FT                   LLPSVHMEFIIEKASKKIMEQNFIIIRKNLEKVLVSYEVQKQVFTLPNREKLMEVANKK
FT                   DYVYSVSDFNSILTNVTVTQNEELEDSITRLSAYGEEGNEIIREFIGKYILNPFIVKTI
FT                   NINDKKGIEIRALIPNLVISSVLEYFKNRKVDDNVSTFMFFAKDTIYMDDNLGMDFASE
FT                   KNIILACNNLDVGSNVKINVSGKSGELVDSSMYGKNGEDGRDAGNIYLYIKEEIRNYRL
FT                   TLIANGGNGSKGIDGKNGETGDSGSNGADAGYTSSFHGQMFKGYFAKGTSGKKGDKGGA
FT                   GGNAGRGGNAGNKGNIYFISDSEEQKNRIINHCDITVKDGEAGPNGRPGSGGYGGSGGY
FT                   HGYNTLSFSPSGIDKTVYYTGYFTSWDYKLDSIIKYHIEFSGGSWNEGKTGPAREYAEY
FT                   GDRGDDGGFNAPNTKLSTAVSKVEENLIKEKYQGYCSEI"
FT   CDS             621890..622974
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0514"
FT                   /note="transposase-like protein b pseudogene"
FT   CDS             625177..630387
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02361"
FT                   /db_xref="GOA:C9YIW9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIW9"
FT                   /protein_id="CBE02361.1"
FT                   /translation="MANKLYSEIVNLLEEGRDELRKYDLKEKSILLFLGASGVGKSTCI
FT                   NYLKGCVMEEKTDEETGQIYITAKDSAVEIGNGVYSKTLCPEVVDIANRNFSLCDCPGF
FT                   FDNRGAEYMIAGAMLVRETISTSSKVKGMVVILDYQSLLDSRHTLLIETGKNLKDMLGD
FT                   YAKYKENFFFLINKIPKTLIGNVTEEKIRNILEKAKEDLDSQEKDYDGCKELVYLLNVA
FT                   LSDGVSIKLCNPLDRQPEKLLDEMKNLPETFEKTDLGLMLTASCKIEIQKAVDVTYKDL
FT                   EKLLVPYIESVKKGMEDSISILSSINSLKDKKTQLDKMYTDLCSRTNNMKELMEFVQEL
FT                   SYGDGVQKVNILEETRLLLELNSYCSETHIVGLSELLKSLLKNTLEDTLKDIKYWIAEE
FT                   EYREEEAKKLEDAEYRIEKIQSCTYIKSYEKENVLSIYIPIPKVNLSDLTKIISGYQLN
FT                   ILSSIYMYGDCELKIDCNMEKEVFSGKNIVLLTEKLCIPEGIYSINVSGKDAEKLVGEG
FT                   SIYDGMNGRNGNNAGTSGDILLSFKEIEKRGELKLYVDGGRGGNGQDGKRGDTGITGEA
FT                   GENAKIGSKKESKEFAKVKGTKYYVVKAEKGKQGGTGGTGGNGGNAGLGSKSGQVYLLG
FT                   KASLLKGAISKKDGNHGLAGKGGSGGAGGAGGLGGIRGIYEETIRYIGTSAPIDDSDRN
FT                   YYYFDRYVFNHASNENQVADDGEKLNALYEKHKDWTISKREDSGLVGAEGKDGRSGDAL
FT                   KEKELLKQEYSLSIDTFFYEFFERFGFSGIKGYRNLRLLCAVGILEADILELSHIYEIF
FT                   HAVEKIEMQLNREILQKYYSFEKKNKAVLSLDDMNIKKEFYKEAKEIYEYLINKLMQSD
FT                   RIESFIGEKKNFSEWSMILFALEQKTAFYVQMIEESEIGGNRVTDIRSLTDYLDKTLRE
FT                   LEQGKKDELKEGYFNTYKESILTQIESGNQQIEVLKDELENKMLSVNAKMNLLIQEIIK
FT                   MKEEEQEDIEELKKKQAKLEEQMKTQLILSGIQSALSLLTAFSGVGQACLGAFDSAKSL
FT                   KENLSAKEEEYQWTNRMVDFSDFKLDSDGMRFVLGEQLSEDRKNALDKMTYNLAGVDEE
FT                   RRTKFDQIKEIIVKSIDDDNYAEKADDIQRAKEGLSESEYKEIYTKIQKKEIGMLEANY
FT                   NNKQQKDKLAALEKSKQAIERQQKTSKIKNALSIGSSACSLINTAISGVNNCLNVKSSF
FT                   ESKIEVVKEAIKDKENNIKKLDELNTQMVEFKDKTLKESVIPFVEKFDSTVKNQDIFEN
FT                   EISKLKMKEVLTELSTKFGSLKMENSEEISIIFKKVQDMMETQIIITDKIDKKKDNLAM
FT                   GELIYQMSGSGNQMNEYQKKLIHQIELNQVRYLCQVEAAAFQLWTFPFGSNIVNILNRC
FT                   HVGITEDENEVINQAKEQNRQIREFLDQDAYQWQKTDNHILKVALTGSLDGKSRVGFEN
FT                   TYSLYDCNEEEVKKLLTGDEISFEVPLNKNFDAIKYVTMYANIPNLRRNILEDSLKVKV
FT                   HIHLYDSGYFSLYDDKKDVYYQYVFPQNYIDITHGLDVKYNDSDSINSIWSSVEDKGIE
FT                   KFKNAGLNSGRSPYSMAKISLKAHFNKKLSYDSLTNEQKKKLESYFDKPSKYAWSESID
FT                   ILKSLGYIDLKGILSKSWYEIKKDIDSDGEIMKHFSILQVDLLERIIYEQTSILKENIP
FT                   NLTIELVGCGIYVESEFNYLKQNDLKCYEERLVENTIIC"
FT   CDS             complement(630612..632711)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0516"
FT                   /product="putative cation transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02362"
FT                   /db_xref="GOA:C9YIX0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX0"
FT                   /protein_id="CBE02362.1"
FT                   /translation="MNFYIKHEIRGRIRFDLQLGKLNNKQSDTLLYYLTSINGITKAKV
FT                   YDRTGDAVIYYTGEREYIIREITKFSFNNSKIENLVPEHTSRELNNYYRDKLANKLLVK
FT                   SISKIFFPKSLRFFLIGLHSIKYFKKGLSSLLNKKIEISVLDATAIGISIFRKDINTAG
FT                   SVMFLLGIGELLEEWTRKKSIDDLAQSMSLNIEKVWLKKDATEILVPISEIKEGDLVSV
FT                   TMGNMIPLDGVIVSGEAMVNQASLTGESLAVNKKEGSYIYAGTGIEQGNIVMCVKEKAG
FT                   TTRFQKIVTMIEESEKLKSSVESKFEHLADTLVPYSFLGSILTYAITRNPIKSLSILMV
FT                   DFSCALKLSIPISVLSAMRECNNHSIAVKGGKFLEGVACADTIVFDKTGTLTKAQPTVS
FT                   DIITFQNYNKKDMLRLAACLEEHFPHSIANAVVYEAEKQGLSHKEMHTEVEYIIAHGIS
FT                   TKVDDKKVVIGSKHFVFEDEKCTIPDGEEDKYNNLSDEYSHLFMAISGKLSAVICINDP
FT                   LRKEAKYVISNLREYGIKKIVMMTGDSEKTAKSIASKVGVDEYYSEVLPEDKANFVKSE
FT                   KLKGRKVIMIGDGINDSPAISESDVGIAMSEGAEIAREISDITISADNLNNLIVLKQIS
FT                   NKLMKRVDLSSKFIIGFNLGLILLGVSGFVRPSTSAFLHNASTVGISLNSMTNLLENTN
FT                   TYNYY"
FT   CDS             complement(632754..633149)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0517"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02364"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX1"
FT                   /protein_id="CBE02364.1"
FT                   /translation="MNILKMKKTGIFLGGVLFGTVGVKILSSDCVKKTCTRATAGALKV
FT                   KDSVLETTTKIQENVEDILAEAKEINEQEDLSTSKVNVVQDTLKCEQEVLKTETIKTVE
FT                   DTNSNNIKCEEIKDNVIEEKNNTCTTE"
FT   CDS             complement(634583..635023)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02366"
FT                   /db_xref="InterPro:IPR024265"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX2"
FT                   /protein_id="CBE02366.1"
FT                   /translation="MYERMLDKSNKPCLSQIIEYIGKDGYARLCKLETYLETQYNLSRE
FT                   LRFPFGNNYGWGYKYSHKSFHLFYAFFEKGAFTVLIQIGDKQVPAVEKTLVSLTPKAKE
FT                   LWVTRYTCGNNGGWIKYRILEDADLLDIIQYIRAKKSPPKQN"
FT   CDS             635359..636672
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02368"
FT                   /db_xref="GOA:C9YIX3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR021845"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX3"
FT                   /protein_id="CBE02368.1"
FT                   /translation="MDKRYLESDVFEAFQERLSYLFNEFDYIYVSFSGGKDSGLLLNLV
FT                   LDYKRKNNISSKIGVFHQDFEAQYSLTTEYVEKVFEENIEDIEPYWVCLPMATRTAVGN
FT                   YEMYWYPWDDEKEELWVREMPVKEYIINQKNNPFTYYKYKMRQESLAKQFGRWIRDIHE
FT                   GAKVVCLLGTRAAESLQRYCSIVNKQHGYKGKCWITKEFKNVWTASPIYDWEIEDIWLA
FT                   HYKFDYDYNKIYDLFYKAGVAPRKMRVASPFNDSAKESLNLYRILDPDVWVKLVARVQG
FT                   VNFTSIYGKTKAMGYRSVKLPYGHTWKSFTYFLLDTLPENIRNSYIKKFSTSIEFWQNT
FT                   GGGLSEIVIRELLRKGYKIELNGVSNHTKDKKSRVIFLDDIPDDTDDIKFTKDIPSWKR
FT                   MCYCILKNDHMCRFMGFGPTKEQRIRTEYIKKKYEKIH"
FT   CDS             636690..637226
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02370"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX4"
FT                   /protein_id="CBE02370.1"
FT                   /translation="MEYKSPVYGIIAVPIEKIESNDYNPNAVAPPEMQLLYKSIKEDGY
FT                   TMPIVCYYNEEKDKYIIVDGFHRYRVMLENKDIYDRENGLLPVSVIDKSLDERMASTIR
FT                   HNRARGSHNVDLMSKIITELCEIGKSDEWISKHLGMEVDEILRLKQITGLAYLFKDKEF
FT                   GNAWIPFGSDIEEEN"
FT   CDS             637745..637966
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02372"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX5"
FT                   /protein_id="CBE02372.1"
FT                   /translation="MGYLKEDKQDYCCEFARPYINRQIYDDTYNPKTALKRGTLFPELD
FT                   LIESNNYNDWLYSNPKNRVRAKKGGNMY"
FT   CDS             637966..638229
FT                   /transl_table=11
FT                   /gene="cotJB1"
FT                   /locus_tag="CDR20291_0522"
FT                   /product="putative spore-coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02373"
FT                   /db_xref="GOA:C9YIX6"
FT                   /db_xref="InterPro:IPR016571"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX6"
FT                   /protein_id="CBE02373.1"
FT                   /translation="MSLNRRELLERISEYQFACIELNLYLDNNPRDKKALDLYNRYCDK
FT                   FTQAVCDYESKYGALTNFGYESSEYPWSWISEPWPWDKSFYK"
FT   CDS             638291..638863
FT                   /transl_table=11
FT                   /gene="cotJC1"
FT                   /locus_tag="CDR20291_0523"
FT                   /product="putative spore-coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02375"
FT                   /db_xref="GOA:C9YIX7"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX7"
FT                   /protein_id="CBE02375.1"
FT                   /translation="MWIYQKTLEHPVNIRQADPRMAKYIMTQLGGPNGELAAATRYLQQ
FT                   RYTMPTGKSRALLTDIGTEEMAHVEIISSVLYQLIGSCTPEELKAAGLGSNYANFGHGL
FT                   QPVDSNGVNFTTSYINVFGDSVTDLHEDMAAEQKALATYYQLINLTDDPDLKDILRFLG
FT                   EREVVHYQRFGEALMDVYEFTECKHQF"
FT   CDS             639681..640214
FT                   /transl_table=11
FT                   /gene="ogt1"
FT                   /locus_tag="CDR20291_0524"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02377"
FT                   /db_xref="GOA:C9YIX8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX8"
FT                   /protein_id="CBE02377.1"
FT                   /translation="MQYISYYHSPIGNILLASDNVGLTGLWFENQKYYAYNLDQEHQEK
FT                   ELPIFEQTKKWLDIYFSGEEPNFTPSLHMVGTPFQTTVWKILQQIPYGKTITYGEIAHK
FT                   VAQQKGISKMSAQAIGGAVGHNGISIIVPCHRVVGTNGSLTGYAGGIDRKIKLLSLEKV
FT                   SVQHYFIPKKGSAL"
FT   CDS             complement(641225..641473)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0525"
FT                   /product="putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02379"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIX9"
FT                   /protein_id="CBE02379.1"
FT                   /translation="MEPDIKDLKTGQVETSSRLDTIQSDVTEIKSDVKINRNTLDTVIK
FT                   HTSSLVEDTSDIKNDLNNIEIVTSKNWNDIAKLKSVK"
FT   CDS             641547..641750
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0526"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02381"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY0"
FT                   /protein_id="CBE02381.1"
FT                   /translation="MPSILLILPCISLIVPSISLILLCISLIVPSIPLILPCISLIVPS
FT                   IPLILPCISLIVPCISLIVPCI"
FT   CDS             642321..642734
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0527"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02383"
FT                   /db_xref="InterPro:IPR024227"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY1"
FT                   /protein_id="CBE02383.1"
FT                   /translation="MKMPKESIDTIMFAPCGMNCMVCYKHCYHKKPCAGCLNSDTGKPE
FT                   HCRKCKIKDCVCQKGLFYCFECFNFPCKLIKNLEKSYNKRYQASLMENSKFVQQYGLEK
FT                   FMQKQKERYTCSKCGGIISIHDRECSECQEKVK"
FT   CDS             642830..643318
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0528"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02384"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY2"
FT                   /protein_id="CBE02384.1"
FT                   /translation="MVKLLEHQMIWDKSAKDVIILLKSIWDKTAIDIQHIGSTSIPSIS
FT                   AKPIIDIVVGVASLEEAKLYLERLEQCGIVFRGQDVPKQLLFAMGDFEKNTRTHHIHVV
FT                   EWNSVAWNNYINFRDYLNTFTDKAKLYDSHKQKLALQFEDNRKIYTQRKQELINILLE"
FT   CDS             join(643505..644170,646061..646963)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0529"
FT                   /product="chloride ion channel protein (pseudogene)"
FT   CDS             644825..645934
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0530"
FT                   /product="transposase-like protein b"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02387"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY3"
FT                   /protein_id="CBE02387.1"
FT                   /translation="MEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIEVYKNDK
FT                   ETFTYKQCSSDLTNLKKELKWLKEPDKFSLQNALKDLDNAYKKFFKEKAGFPKFKSKKI
FT                   NRFSYKTNFTNGNIVYCGQHIKLPKLGMVKIRDKQVPQGRILNATISKEPSGRYYVSLC
FT                   CTDVDIEAFENTNNQIGLDLGIKEFCISSCGEFIENPKYLKKSLNKLAKLQRELSRKTI
FT                   GSLNRNKARLKAARLQEHIANQRNDFLQKLSTKLIKENDIICIEDLQVKNMIKNRKLSR
FT                   SISDVSWSEFIRQLEYKANWYGRQIVKVGKFFASSQICNKCGYKNEEVKNLNIREWICP
FT                   SCNETHDRDINASINILKEGLRLITIQNK"
FT   CDS             647572..648585
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0531"
FT                   /product="putative membrane-associated metalloprotease
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02389"
FT                   /db_xref="GOA:C9YIY4"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY4"
FT                   /protein_id="CBE02389.1"
FT                   /translation="MVSSFLNDIFRTILVSCIFIVILLVFRITLFKTFSKKFNYYIWLI
FT                   VIIKLSLPFMNYTFIFNESKYNGNINKISLGNFNSISIVYSTVLVSVWIAITIFYLVYT
FT                   LLKYIKLKNMINDLSYDVEDDKIKNLYENLLKELKINKKIRLKYSYEVESPVFFNSCVI
FT                   LPPCDYTLKELNWIFRHELMHFKSKDLYIKYLVIFLKCVYWFNPFVYIMEKFIDLDCEF
FT                   YCDERVLKNCTIEEKQDYALTIISAMRKGSNSSNKFVAGLHKESDIKKRVFSMFNEKYR
FT                   NGILIAVILCLLSSITYFEIDLITTKSIFYPLSKQTPIENRTNSKPTYQINVYIDN"
FT   CDS             648941..649510
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02391"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY5"
FT                   /protein_id="CBE02391.1"
FT                   /translation="MKKKLEDMTLEELWNLFPIFLTTHKECWKNWFKEEQYRLTGILPM
FT                   QKIVRISHIGSTSVSTIYAKSIVDILIEIIPDYNMKDIKDLIESNGYICMSESSSRLSL
FT                   NKGYTVDGFEERVFHLHIRYVGDNDELFFRDYLIDHPDVAKEYEKLKLDLWKKYEHNRD
FT                   AYTDSKLDFVREFTEKAKVLYSNRYN"
FT   CDS             complement(649847..651184)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0533"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02393"
FT                   /db_xref="GOA:C9YIY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY6"
FT                   /protein_id="CBE02393.1"
FT                   /translation="MDTYSLISTSINFILILINIFIAFFLYKLTSYFIDFRNHWIFKII
FT                   LILGYSIISQMIIWLSDPVNILFTLFGYFILLIICSKSKLIPIISVVMILYPIIIGLNF
FT                   LFINNPIYEELIHSKEYILILSIVQIISALIKLLFWFLIHIFLKNRLVNIKQYLSNKIW
FT                   IFIDMVCISSFLSILIAIILPPTNLIPMGSNKNIILGNLPYGTYLIILSAILANIGVIL
FT                   LLQPLIENVKMKIEKQANHLKEKYYNLLENQQIQIRKMRHDMNNHFQMIESYLEIEDIA
FT                   GAKKYFNQLKIGIGTLSGKQFCKNQALNSILNLRHTSLEENGVDVHFNIDIDNHLGIEP
FT                   IDLCTIFSNSLDNAIEASLKIPDLSNRKVVLKARCEKEYFSYLLTNNKVNPINRKQELF
FT                   ISDKKDSNSHGYGIENIREIVNKYNGKLDISYTENEFSLFLYIRLF"
FT   CDS             complement(651624..652352)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0534"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02394"
FT                   /db_xref="GOA:C9YIY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY7"
FT                   /protein_id="CBE02394.1"
FT                   /translation="MKGDKKLTSICICDDEKQQRNMLNKIITREMDLWGYPYQIKEYSN
FT                   GESLVYNLEHENYYIDIIFLDIELEKSNGVDIAKTIRKHSKDTIIIFVTGFSDYVFHGY
FT                   DVGALNYILKPYKTEKICKVLKEALKKLEQWKENFITVHIGTNLCKINTKDILYFKSEL
FT                   RKLTVVTFDKTLEYYGKLNDMETVLPSNFIRTHQRYIVNLNHVDSITQTYAKVQNEKIP
FT                   ISRKKYQEVVGKFTRYMLEP"
FT   CDS             complement(652948..655059)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0535"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02396"
FT                   /db_xref="GOA:C9YIY8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY8"
FT                   /protein_id="CBE02396.1"
FT                   /translation="MTINKLYSKLRAYNWKNYTTLFFCIILSVVLVTSYALIYFSPTIQ
FT                   NILPTGGDSRKQATMIFSVAILGCAVFTTYASSLFLKFKSKEIGIFMALGTDKKKLKKL
FT                   LFSEILLISIVCCFLGLILSIPVSFGIWKIFQLVIIDTREMTYHFGTQGFIYGFIFSVF
FT                   VTLCIFILSVKFINRTNIIDILNDQRISEPIQDVKDWYGILGIIFIILGIFLGYIVPSL
FT                   TINKLNYRLPSVWSFTYLLSLIGIYMIMTYIVVHAKRGKHPEKYYKNIISTSMMRFMGR
FT                   QTVKNMCVISFLIAGALFAVFYVPNMVAGIYDTLKNNPIDYTFTYNQRDKQVSKKDIEQ
FT                   LADKHNIKIQNYMEIPSIELIVDGVESIYHKDGTIERVYMKKSSYDMFFNSKDFSKLID
FT                   KPITIKNGEYLAVVNKGNENQDYKYTKFISSPVTEKEIPFRYAGKIIFNGSFFQNRSMN
FT                   AYVLNDEDYKSFTKDLSIKNYNNSILFNVDKDTYAFANDLKKEIIKRTSKEMGMFSGYD
FT                   EYVKKRYESTGRKYFMDEEYPSGEGHLKLDPNNNQLYLNWKYYPNFKILQSQDMIKNMA
FT                   VFLMLFIYVAIICFTAVGIIAYTRGVTIAINHKQVFMDLNRLGANNDYIKFCIRNQLKK
FT                   VFSYPLIAGSFLIYLFNFMIMLNNDGRIVNSEVNALLINLGFIGICGVYMYLIYLLTYK
FT                   KFKKIIGIL"
FT   CDS             complement(655049..655822)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0536"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02398"
FT                   /db_xref="GOA:C9YIY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIY9"
FT                   /protein_id="CBE02398.1"
FT                   /translation="MKVRMIYMLKVNQLCKSYKTGNKTYPVLKNISFEINKGEFVAIMG
FT                   SSGSGKTTLLNCISCFIPIDNGEIILGNNNIRNLKEKELSEVRNQQLGFVFQDFMLFDG
FT                   LSVFENICVPQIIKGSQVLQMENRAINLCELFGIEHIRKKYPAEISGGEKQRTAVARAL
FT                   MNNPDLILADEPTGNLDSKSCRTVIESFLKAKQELDATILMVTHDSFAASFCDRVIVLK
FT                   DGIIYKEVVKSNSRHKFLDELLEVLKEMGGAQDDN"
FT   CDS             complement(657097..657273)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02400"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ0"
FT                   /protein_id="CBE02400.1"
FT                   /translation="MFFTFIGVISAILLLCTIICGLWIKLNNRNNDSNSHFTFSILSIA
FT                   FSLLIVVAFLVRN"
FT   CDS             complement(657377..658027)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0538"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02402"
FT                   /db_xref="GOA:C9YIZ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ1"
FT                   /protein_id="CBE02402.1"
FT                   /translation="MIVSKRVLNMFNFFMEKLLRGKIMKADSTKEQLINATIQLLSSHR
FT                   DVSSITAREIVAKANVNLAMINYYFKSKEELINISIKKFLKRHMDEYKATHDTKNLAPK
FT                   QQLREILIAFFDFIGEHSQFIKISVPYILIQEEIVYPFEILPLIKAHYENQNNKKTEAE
FT                   YRTIAYQITSFIQLLFLRSNAFFKYSGIDILNVEQRNGLIDFQLDLLLVDITK"
FT   CDS             complement(658084..658908)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0539"
FT                   /product="MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02403"
FT                   /db_xref="GOA:C9YIZ2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ2"
FT                   /protein_id="CBE02403.1"
FT                   /translation="MFKIGEVSKLTQISIRMLRYYDELGILKPAEIDKYTGHRLYSVEQ
FT                   ISILQRIVLLRDSKFSVAEIANIVHNWNDEFVIKELNRKKNEIQKEIKHEQQRINKIDK
FT                   FIEAINCDKDEIHYNVVFKKIPSYKIISLREVVPDYQSEGILWEKLSKFIKEEHIEVSR
FT                   QPNNNIAFYHDEEVKDNGVDIEVGMVVKKIGKNKSGFIYRETEEIDMMACTMVYGPYEN
FT                   IAGAYESFCYWLDKNSDYQISGINRQIGHKGEHNEINPENYLTEIQIPLIKV"
FT   CDS             complement(659086..659979)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0540"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02405"
FT                   /db_xref="GOA:C9YIZ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ3"
FT                   /protein_id="CBE02405.1"
FT                   /translation="MQLYNTPFNTNKHLIYFFTSTLVLNWIFSLTPALLGITNTILGEI
FT                   IFYLAYTSPAIVGLFFISTIYPQSAKQDFIYRYLSFKEIRIKWILLTILFFALTFITSL
FT                   IIGNYFNVKTSDIDWIHIAVFRPSKIAYMLLASFILSILSQEAGWRGYAIDKLLVRFGF
FT                   IGSSIILGLVCGIWYLGSYFTPNQIPYNLAQYSLFDAFLFIPNIVLLNFIINFVYINTS
FT                   RSILSAGLVHMMYYFFNIQLLLHYPIKLCVIAQYVQIIFGLIFLVYMISSNKFKQKVNS
FT                   EIEQIKSDDFEFELDW"
FT   CDS             complement(660236..660673)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0541"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02407"
FT                   /db_xref="GOA:C9YIZ4"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ4"
FT                   /protein_id="CBE02407.1"
FT                   /translation="MKIHVEQGINCDDIEITIKCSALDNNIEKIISLLSTPLLDIKGKK
FT                   SGEIYKLNVCDILYFETVGNKTFAYYEDDVFEIDLKIYKLSKLLANTSFSRISKSMILN
FT                   MDYIKSIKVISHNRMQATLKNNEKVIINRRYIKNIKEKLNI"
FT   CDS             complement(661092..661322)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02409"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ5"
FT                   /protein_id="CBE02409.1"
FT                   /translation="MEIKKKLVMSFKNVKDKQVSFSIENPKDDLTEENIKSVMDLIVSK
FT                   NIFSVGGFDLASVVEAKVVETNTTPYDLVIE"
FT   CDS             complement(662014..662235)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02410"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ6"
FT                   /protein_id="CBE02410.1"
FT                   /translation="MEVVSTKNLSSIKLKLDAGFDDKGKAVVKSKSFANVKAEALNEDV
FT                   YAVAEAIASLQENPIVDILKLDSTSLSK"
FT   CDS             662660..662800
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02412"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ7"
FT                   /protein_id="CBE02412.1"
FT                   /translation="MRNFIKVNTKINFKAKKFFIRFNKTNKYSLVNNVLNKNFVKSIKI
FT                   S"
FT   CDS             662815..663072
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0545"
FT                   /product="putative phage-related regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02414"
FT                   /db_xref="GOA:C9YIZ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ8"
FT                   /protein_id="CBE02414.1"
FT                   /translation="MKIKVEDIPVQFHAMVEIIGIDKFIEVAKLYGGTNTYIPTYKGLF
FT                   RYARNRDIVKQFNGVNHNELAIRYNMCVSNIKRILNENNV"
FT   CDS             663506..664759
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0546"
FT                   /product="putative phage-related regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02416"
FT                   /db_xref="InterPro:IPR011741"
FT                   /db_xref="UniProtKB/TrEMBL:C9YIZ9"
FT                   /protein_id="CBE02416.1"
FT                   /translation="MGEIEMNKGFYKLNSVVLNFDIKNDVNKIRFNHYIMRKENIQRLQ
FT                   GTLPNGQFYMTVRRAATDLQLSISTISRLVKEFLDLGIIRLVSKGVKGNRSVYSYVSIE
FT                   FNGSLFDDSKYMELDCVCNDEFIDNSGIEFDCDSKDNSFNGDINVETVHCINEYFSDDD
FT                   VEHNYNNFHNKDTIKDKAISNISTIKKYIDESFDTNKSENSNLQQESINFNFNDTCNEI
FT                   DKRTNNSIENNQNKRPMRLSDISVLSDKGMTNKKNYFNHNHGIQKRNKSATKKKESLNK
FT                   FNKKNIQQSIINMLNKKSGKNFKIDSPISIKLINERLKEGYVLEDFYKVIEVKVAKWKN
FT                   TIMEMYIRPETLFSYKFESYVNENISMKSQSNVHPCKEGNSNDSSNYIHSDYTTYDGSV
FT                   RERKKYENVRYWNPICEI"
FT   CDS             665465..666766
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0547"
FT                   /product="putative phage-related replicative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02418"
FT                   /db_xref="GOA:C9YJ00"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ00"
FT                   /protein_id="CBE02418.1"
FT                   /translation="MGKSKDVEIEKSILGTILLDNKLSYKLDELNENMFMNDICLEIFK
FT                   IMKELKKENIVIDVATVKSKIDRKSLAIKTSDVTNLITWGQNFGLDGHIKILKENLARR
FT                   SINQNCQNLLHSLNLGENIDTCIYKFESNIKEILDKDTYENDDVNSIAGKVLDFLENKK
FT                   DIGFKFGIKLLDTTIGGLFKGELTTIAAKSGVGKTALALQIMLNSFKQGKKTLFISREM
FT                   TSEQVFMRNICRVTGVSTRNMKSKEIDENDWKLIVNAIGDLSENNLIYINDKIDTISAI
FT                   RKRIRQVKPDLLIVDYVQLLTSQKSMDKREREVATFSRELKNMTLDFNIPVIQLSQLND
FT                   EMKDSRPYGDRPMRDSKAIYHDSNNVVYIHQLKGSDYEEAVRDIGESEEAVRASEYRGI
FT                   KMVDLIVAKCRDGQTRHKHFCYFGDKLHFQELNY"
FT   CDS             666842..667117
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0548"
FT                   /product="putative phage positive regulator of late
FT                   transcription"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02420"
FT                   /db_xref="GOA:C9YJ01"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ01"
FT                   /protein_id="CBE02420.1"
FT                   /translation="MLELTKIIELLEEHKIEVSIPKELHKYSLLEYLELCQQSGGTYFY
FT                   IKTLEGALKEARNELMIKLFNGKNYMELARMFEMSVINVRHIVRKK"
FT   CDS             668442..668672
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0549"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02422"
FT                   /db_xref="GOA:C9YJ02"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ02"
FT                   /protein_id="CBE02422.1"
FT                   /translation="MSNKKKKYANILANECVACGSCIKACPRSAISVPCGISAKINRDL
FT                   CVGCGICEKICPASVIEIITILKEEEGKCHE"
FT   CDS             668665..669246
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0550"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02423"
FT                   /db_xref="GOA:C9YJ03"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ03"
FT                   /protein_id="CBE02423.1"
FT                   /translation="MNNKKHWYDYLWIFSSIYLVLGFVNIIFAWIGLICFFVPLAISIV
FT                   KGNKAYCNKYCGRGQLFNLLGNKLKLSRNRDIPKFIRSKWFRYGFLTFFMVMFANMLFS
FT                   TYLVFEGSRNFKEVVTLLWTIKMPWQWAYHGTLVSPWVVQFAFGFYSVMLTSTVLGLIT
FT                   MILFKPRSWCVYCPMGTMTQMICKAKSKSV"
FT   CDS             670169..671854
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0551"
FT                   /product="abc transporter, atp-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02425"
FT                   /db_xref="GOA:C9YJ04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ04"
FT                   /protein_id="CBE02425.1"
FT                   /translation="MKYLIEIAKKERLLVFIYLALGIGIELLNSFSANYYQSLIDRFNN
FT                   STINFHIIFIYGTVLVTLCLLRYIDEYPGRRLEHSFFLDLKLKALEKMSKIDYLEYQML
FT                   GTGKLIQKIENGANAGRNIFFNFLLAVVRKIIPSILFSMVFIYRIDKKVMFTILIGYFI
FT                   VFIITNLLIKALYQIKEHILINEEKMNHFLVRGFVEMVVFRVNKRFEYEICQSKFAKKE
FT                   IIDSRVKMTLIHEAFFTIFSLIVTFIKMLIIVYSWKTKTISIGSIIALITLLDNAYTPI
FT                   AIFNVLYIQFKLDKAAYKRYTDILELNNDGQLLAGKEVNLMYGNIEFNEISFLYNNKRE
FT                   IFNKLSLSIKSGEKVAIVGESGSGKSTLIKLLIGLLKPSEGTIFIDDYNLLEMNLNSYY
FT                   NYVTYVSQDSPIFDGTLRENIVFGKTIKSNDIIEVLEKVGLKNLYLKLEAGLDTKLGEK
FT                   GTTLSGGEKQRLALARLWFSDAKIIILDEATSALDNITEEKVMLNVMEFLKDKTTIMIA
FT                   HRFNSIKNVENIIVLKEGSIIGSGSFKKLLDGNLYFRELYYTMS"
FT   CDS             complement(672334..673011)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0552"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02427"
FT                   /db_xref="GOA:C9YJ05"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ05"
FT                   /protein_id="CBE02427.1"
FT                   /translation="MISQNEIDILTHSLPFWDKLTDLQKELLISSANTSDYKKGNPVHC
FT                   GDSDCIGILIIKSGTIRTYILSDEGREVTLFRLDDGDVCILSASCILKTITFDVYVDAE
FT                   TDCDIIQINSSVFAKLSTENIHAELFSYKLATERFSDVMWAMQQILFMSFDKRLASFLI
FT                   DEIAKNGSSTINMTHEQIAKYMGSAREVVSRMLKYFAREGIVSLSRGGIKVLDKDKLRS
FT                   LTL"
FT   CDS             complement(673200..674564)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0553"
FT                   /product="putative drug/sodium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02429"
FT                   /db_xref="GOA:C9YJ06"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ06"
FT                   /protein_id="CBE02429.1"
FT                   /translation="MKESNKKIELLGSAPISKALLSMGLPTMIGMMITALYNLVDAYFV
FT                   GGLGTSQMGAISVAFPLGQLVVGLGLLFGNGAASYIARLLGHGDNEKAGKVVSTSIYSS
FT                   IIVGTLVIIVIMIFLNPILKLLGATKSIMPYAISYASIYVVSSIFNIFNVTMTNIVTSE
FT                   GAAKTTMCAMLLGALLNMILDPIFIYTFGLGVRGASIATAISQIASTLVYVGYILSKKS
FT                   IFSFRINECCFSKEIFSEILKIGIPTLIFQLLTSLAITLTNMEATKYGDSVIAGMGAVT
FT                   RITSLGSLVVFGFIKGFQPIAGYNFGSKNYDKLHIAIKTSILWTTIFCVVLGLILVLFP
FT                   KSIISQFTSGDILLIENGSKALRANGFSFMLFGFYTVYSTLFLALGKAKEGGFLGMCRQ
FT                   GVCFIPIILIIPVFYGLNGILYAQPIADLMAAIIAGFMSIRLHKELNLLKINGMH"
FT   CDS             674683..675213
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02431"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ07"
FT                   /protein_id="CBE02431.1"
FT                   /translation="MIFMATIDLIVLGIVKQQPKSAYDIQKAVEYRNISRWVKISTPSI
FT                   YKKVIQLEQKGYIESKTVKNGKMPEKAVYSLTELGETHFLDLMFDTSSKPINILLDFNA
FT                   VIVNLNSLTPEKQKLCLNNIEENVQELKKTIEENIIIKTEVPETAKAVLEQQLVLAQAL
FT                   ETWINSLKDNMGN"
FT   CDS             675802..676881
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02433"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ08"
FT                   /protein_id="CBE02433.1"
FT                   /translation="MPELLKNMYNRESLYEVAVAIQSVYNSFKVDEFIKSTMDETWNNL
FT                   ELKARCRKISMSLGMYLPEDYKEALSILEKSVTGFYFAFFFPDFVEVYGQDEINWDLSI
FT                   SALERNTEYWSSEFAVRAFIIKDEERMMAQMRKWSKHKSEHVRRLASEGCRPQLPWGQA
FT                   ISKFKKDPTPVLPILEQLKTDTSTYVQKSVANNLNDISKTHPDLVISIAKDWYGKNKST
FT                   NWIVKHGCRTLLKKGNRDVLALFGYDDTTSINLQDFTLETTSISIGEDLTFSFNILAKK
FT                   ATKTRLEYGIDYMKSNGKRNRKIFKISEVSLKENEKKSYMKKHSFADVSVRRHYPGIHS
FT                   ITIIINGVEKGKLDFELGV"
FT   CDS             677205..677573
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02434"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ09"
FT                   /protein_id="CBE02434.1"
FT                   /translation="MDVYSFWNDTLAQDAVKIRKYFHEDAYINWHDTNEHFTLEEFIIA
FT                   NCEYPDKWNGKVERVLEFGNLVITVTHVYAINKPLSFHVVSFISLKDDKIISIDEYWGE
FT                   DDDVPQWRLDKHIGKPIK"
FT   CDS             677690..678493
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02436"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ10"
FT                   /protein_id="CBE02436.1"
FT                   /translation="MEEKYILSDRGKVYYWIKESNSVFAKNLIFLPGLTANHHLFDFQI
FT                   QYFSKNHNVLVWDAPAHGKSRPYLDFSYSNLVEELKVILDKQNMKKVVLIGQSAGGFVA
FT                   QSFIVKYPNMVEGLMMIGTCPYGTDYYSKSDIFWLKQTEWMLKLFPDKLLRNIISKMCG
FT                   ATSEGRRSMMKMLEGYEKKELCHLMYLGFAGFMPEIQDLNIHCPVCLVVGDKDKTGKVR
FT                   KYNEQWHNKTGYPLHIIKNASHNVNVDKPSELNQIMDIFIKQLNI"
FT   CDS             678878..679768
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0558"
FT                   /product="putative radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02438"
FT                   /db_xref="GOA:C9YJ11"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ11"
FT                   /protein_id="CBE02438.1"
FT                   /translation="MIESIPAKQILQKVKFDNTRWFGIDYNMNLYRGCSHGCIYCDSRS
FT                   TIYNIENFDKVRYKENVIEILSKELRSKRKKGVVGIGAMSDTYNPFEKQLCITKQALDL
FT                   ISENHFGVSIDTKSSLVVRDIPILQKIKKNNSAIVKLTITTANDELSKKIEPYVNPSSA
FT                   RFDAVKELNDSGIFCGILLTPMLPFLTDNKDEIRAIVEKAHKANAKFIYCMYGVTMRSG
FT                   QREFFYEHLRDISPKLVLKYQKTYGLNYVCTIQNKDSCEKLLREECARYGILTDMKEII
FT                   KAYKRSESYIQIKFF"
FT   CDS             680231..680674
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0559"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02439"
FT                   /db_xref="GOA:C9YJ12"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ12"
FT                   /protein_id="CBE02439.1"
FT                   /translation="MIEIKTIEINKKSQIDLLMLADPCEEMIDKYLNKGTMYALYDNKE
FT                   LTCIAVVNEISKEICELKNIATYEHFQNMGYASKMIYHLLDVYSKKYSSMVVGTSESGV
FT                   PFYEKFGFVYSHKIKNFFVDNYPEPIFEGELQCVDMLYLSYNF"
FT   CDS             680816..681016
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02441"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ13"
FT                   /protein_id="CBE02441.1"
FT                   /translation="MFILNFGGLIMDSNNNTIKSTVKKGISFGSCLAMIISYTAWKSIP
FT                   WAIFHGLMSWIYVLYYWVKYA"
FT   CDS             681567..682475
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02443"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ14"
FT                   /protein_id="CBE02443.1"
FT                   /translation="MTSENVGEVVTEDGYAKPEYDEVFKSLFTLNNDYDLLANFINDIL
FT                   KDAPYANRNIKPFTHIKRIIKAETDPTINYIGEKRPRLYILAEDEESNHINIEMQRALE
FT                   DDYLERAEYYLSRVHGRKLEEGKEYKEIGKTVGIHILNHVKYNHIEDYVNCLRLTMDGH
FT                   PNIYSSKTALYFIELPKIRKSSCIANRVLIWGKLIDNPSHIDIRILSKTDYVIKRALDR
FT                   LKELGSNEDYLLNLKRGAYIMNKSRNFKEEIFQEGVEKGKREEKFNIIIKLKNKGYNLS
FT                   EICDIIDDLNKSEVEKIYNQN"
FT   CDS             682655..683143
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02445"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ15"
FT                   /protein_id="CBE02445.1"
FT                   /translation="MKFYTIQTLEFWNNNKNNKYLSNDYSFILEDFDIPYKWMYSQMTN
FT                   RIYEFDDSMIWVWTKRPDLRCSGYLEKGKKGVLLEIEISEDNVLLSEFDLWHLPLMDIT
FT                   VELYEDEQIEKKVSWERIFDLELCSKLNEVNIEDLTLQGVTSKVPLSNVKLIKEFVAK"
FT   CDS             683229..683636
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0563"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02446"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ16"
FT                   /protein_id="CBE02446.1"
FT                   /translation="MSKQQTGIKSTLISEILGISYCIGATLVNKYFFKGSSIEYLPIII
FT                   WVLAMGAQWVYNKKYDDLIDEASKCILSRVNDIAIKVLFFSVAIVSIFLVTLDINVSNL
FT                   NIGMSLLVILFIQSLLKLILFIYFDRKGIYN"
FT   CDS             683637..683855
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0564"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02448"
FT                   /db_xref="GOA:C9YJ17"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ17"
FT                   /protein_id="CBE02448.1"
FT                   /translation="MSVLLKTKIKSYREKNLMTQGELAKSVGVRRETIVHLENGRYNPS
FT                   LKLAMDIAKVFDTTVEELFEFIEENNI"
FT   CDS             685290..685979
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0565"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02450"
FT                   /db_xref="GOA:C9YJ18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ18"
FT                   /protein_id="CBE02450.1"
FT                   /translation="MDILLVEDDKNIREMVYDFLISENYFVKTAVDGNTAIEIFKNYSF
FT                   DIILLDLMLPKSSGFEVLKYIRSVSVVPVIITTAKDSDTDKMLGLNLGADDYITKPFSI
FT                   VELLARIKANIRRATVYSSSRNSEDMVIQYKDLIINISKYVVSKNGIDLNLTHTEFEIV
FT                   KLLATNQGRAFSKEQLYNTIWKEPYYGNENVLNTHINRLRNKLSDGIEKNNYIKTLWGI
FT                   GYKMEEE"
FT   CDS             685979..686896
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0566"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02451"
FT                   /db_xref="GOA:C9YJ19"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ19"
FT                   /protein_id="CBE02451.1"
FT                   /translation="MELFLVVISIVLFAFYLKERNKSKKMESDYKYINSRLRDITNDDE
FT                   INYILVPSDISIVKETAVDINKLLEKFYSRQINYNRSEKAILQIFTNISHDLRTPITVL
FT                   KGYIEMLYLQSQKEELSSSMRATLEKMQTNSNELVNSINNLFNMAKIQSGDMILNLQKS
FT                   NLTQLCHEIILEFYDLLDKENFNVEVNIEDRPIYANVDTEALQRILKNLIDNAIKYGSD
FT                   GRFLGISLYEKEKHVFIDIEDKGSGISETEKEHIFTRAYTADRKKGNGLGLAISQGLAN
FT                   SMGGSIYVNSRPNVKTVFTVKLKS"
FT   CDS             686966..687895
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0567"
FT                   /product="putative lantibiotic ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02453"
FT                   /db_xref="GOA:C9YJ20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ20"
FT                   /protein_id="CBE02453.1"
FT                   /translation="MMNYIIETHQLKKIYKDKAVVNDVNIHVKKGEIYGFVGPNGAGKS
FT                   TVMKMLLNLVKPNSGEIVMFSKKVAETDFEILKKIGTIIENPYFYENLTAKQNLDLHCE
FT                   YMGYYNKEHISEVLECVGLSKQSNKKVSKYSLGMKQRLAIARAILTKPELLILDEPINA
FT                   LDPEGIREMRELFRKLNTDYGITIFISSHILSEVEQIADTIGIIQDGKLIKEISMSDIH
FT                   KYQTDYVEVDVDNVELAGYLLEKEFGIKDFKITSESCIEIYDLRKDVKEISKIFIKNQI
FT                   GINSIGRKQSSLEDYFFQTTGTGGIETL"
FT   CDS             687892..688572
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0568"
FT                   /product="putative lantibiotic ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02455"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ21"
FT                   /protein_id="CBE02455.1"
FT                   /translation="MIHLMKLELKKVGLKRYFLFSILGILLCMFFVFTGLNDKSTSIYD
FT                   YDVTFRTISLVFCFYYIILFAVLNVAYIINEYTNKTILILFSYPLDRKKLILSKLLLIT
FT                   TLMISSMIVGYICCFTFVVVLDKYFNLVIGDFHISILSYWIPGAIKSIIVFCSLGIWTF
FT                   VVGMIRKSIPVTLVSSIIFINLRQFILAGTNTTQDSLISVFIIVGITVIGIYYILNHKV
FT                   TEID"
FT   CDS             689017..689718
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0569"
FT                   /product="fic family protein; putative filamentation
FT                   induced by cAMP protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02457"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ22"
FT                   /protein_id="CBE02457.1"
FT                   /translation="MNNSFLDKLIETKELKNSLYNVLKHNFLYHSNKIEGSTFTTEALA
FT                   LLLDKNVVTGRHTLDDVQETVNSSYVFDTVIDSLKEKITHNFLRNLHSSLIFNTTLHSR
FT                   GMAGIYKTIPNMILGTDVSIAQPFEVEPKLDELIEWYYSQSEVSIKVIAEFHYRFELIH
FT                   PFQDGNGRIGRFVMLKQMLENNLPIKIVSWDSEDLYRNSLNSCSLGNYVPLIEYLSSLE
FT                   DFREVYKMLWK"
FT   CDS             690613..691272
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0570"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02458"
FT                   /db_xref="GOA:C9YJ23"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ23"
FT                   /protein_id="CBE02458.1"
FT                   /translation="MRVVKVKSNLDEILYHKIIESLIRGEYSVGQKILLNDLCEKFEVS
FT                   RTPVVQAVKMLNKDGVLTIMTNGKVYVPEYEYDMVKQVCETRTLIETYALEKMMQEEEE
FT                   VFQQKLDVIKRYSDKCEEYYRQEKSVELALADLELHKAIVEGANNEILNDVYVGIQGRF
FT                   IVVNYLIRPLKNRNYEGTVQDHFEILKFIEDRDTKKAVDKLRNHIQGTIKRFCEDE"
FT   CDS             691550..693616
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0571"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02460"
FT                   /db_xref="GOA:C9YJ24"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ24"
FT                   /protein_id="CBE02460.1"
FT                   /translation="MKEVVESLKKITKERIENTMKKLFTSETFLEYQFISDCQISPDGG
FT                   YTAFIVKKADIKENGYTSQVYILNNKTGELKQITSINSVGAYVWEDENTILFPALRNEK
FT                   VKEAVKNGKQCMSYYALSLNGGEAEELFRLPIKGGKLNPIGKGLYAVIDSYDNDRPIVE
FT                   GLPEEEQQKKINAYNKRHYEHFKEIPYAVNGEGYISRKRKRLYIYDSNINKLKAITAPM
FT                   FNVVGMKISDGKILYIGQEFKDVKGLKNGVYVFDTNTNTNICILEKDKYIIKGFELYQN
FT                   QVILNLTDALSYGNGENGDFYTIDIDTKEMKLLSGHQHHCIGNTVTSDVKMGAGQTTKV
FT                   DGEYIYYTSTVDMDCIIERIHIPTGKQEKVTQTGSVDFIDVKDGNIVCVGCLGNGLPEV
FT                   YTVENGTLCKKTHLNDHILEEYKISVPEYIESKGSSKWEIQGYVYKPVDYEVGKKYPAV
FT                   LAIHGGPRLTYGPYFMHEIQVFTSAGYFVFFCNPRGSEGRGNAFADIRKQFGDIDYIDF
FT                   MEFTDTVLEKYTDIDKTKLAVEGGSYGGFMTNWIIGHTNRFAVACAQRSIANWSSMEGT
FT                   TDIGYYFCKGQTGASHMENHELQWKQSPLAYADKCVTPTLFLHGEKDYRCYMQEAFQMF
FT                   SALKIHGCPTKLCLFEGENHELSRSGRPKQKLQRLVEMLDWFSVYIKKDNIGQ"
FT   CDS             693633..695588
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0572"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02462"
FT                   /db_xref="GOA:C9YJ25"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ25"
FT                   /protein_id="CBE02462.1"
FT                   /translation="MEKIKIESSDIFEYIFPHDISCSPDGKHIAYIISNINEEKDCYEH
FT                   DLYVMDIKTEKQIHMTQTKDVTSFSWISNTELLFTSKRNKPKAGTTDFYTISIEGGEAK
FT                   EAFSIPKACSVPVSLGNKLWLLTTKNPTDSKKSEPDRAVEGVDYWTFTDKPFIRDRENF
FT                   SQRRRVTLELYQEGENITKAITPKFCEVAGIDVSSDKNRILYTGQIYEDCATPFSGLWE
FT                   YHIDSGETKELVPQGKYQISLAKYIGKDKVMLQASTLERSITQNHDIFILDLSTSEINM
FT                   IASPDGMYATLLDVDAVYGGGRSNKVIGDKFIGARICRTMTEFNEFDTKTGNIRIITKV
FT                   DAFTSFDIYDNTMYTVMLKDYELAEIYSIDMTTGTMKKMTAFSKPYLDTHKVSLPEKLT
FT                   FVAKNKEEVDGFVIPPIDAKEGEKYPAVLFIHGGPKWAYGYMFTHLKQCVTSKGMYVIY
FT                   CNPHGGDGYGEKFLEMVERWGYVDYEHLMEFVDTCIEKYPGIDADRLGVAGGSYGGYMT
FT                   NWIIGHTDRFKAAVSQRGISNLITASLIIDFGDRIMKQTCGDKTPWNHEEVLWNHSPIK
FT                   YVKNVKTPTLFLHSDRDYRCFMGDTFQMFTALKQLGVDTEMYLFHGDTHGLSRNGRPSN
FT                   RIARANAIVDWFERYL"
FT   CDS             695604..696794
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0573"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02463"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ26"
FT                   /protein_id="CBE02463.1"
FT                   /translation="MSDMLLWFSVVLVLFAIGDLIASKTKAKVSAVFVTLLLFLILFVT
FT                   KAIPADIIEKAGMTAAASWSVPMIMFSMGTMLNVKQFIDEWRTVLTAWLGIVAVIVCVS
FT                   LCIPLFGKSTVLTSIPVINGALPATTIMTQAALEKGLTLAAATATVVFAIQKFIGTPIA
FT                   SRAALQEANRLLVEYHEAKSKGIDLANVDTDKKEAENTGTKVKQAFCEKYDKYYSTNVC
FT                   IFFIALFSYLGYELSEIIHVNYSIVCLVVGVIVTRIGIVPKDILEKGKIKGFINMVVFA
FT                   AVIPSLAKVSLTDLISLFVPIVGMFAASIIGIFLMMKVLPGWKIIGSKPLAFGVGFCQM
FT                   LGFPTTYLISNEVCNAVGETEEERAYLMSKIMPKLVVGGMACMISIVVAGLMVPML"
FT   CDS             697928..698302
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0574"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02465"
FT                   /db_xref="GOA:C9YJ27"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ27"
FT                   /protein_id="CBE02465.1"
FT                   /translation="MKVLISNTSDKPLYQQIKEQIKEAIFTEELKEGDAMPSIRNFAND
FT                   LKVSILTIRRVYEELENEGFLTRQVGIGTFVSTGNLEILRDSKRRIVEQKMADMIKDAK
FT                   ALGITQIELQEMMGILYEED"
FT   CDS             698289..699161
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0575"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02467"
FT                   /db_xref="GOA:C9YJ28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ28"
FT                   /protein_id="CBE02467.1"
FT                   /translation="MRRINMENILEVYNLNKTYTNFSLSNISFVLPEDCITGFIGVNGA
FT                   GKTTTIRSILDVVKRDSGKIKIFGKDFDGNEKELKNRIGVVFDDSYFYEELSMSEMKSI
FT                   IAPSYDNWCEEDYQQNMKRFNLNPKQKIDTLSKGMKMKFALALALSHKAEFLIMDEPTS
FT                   GLDPLIRSQILDILTEYMKKCGRGVFFSTHITSDLDKIADMIVMIDNGRIILEREKDTL
FT                   LDEHRKVKGDIQFLNDEIKKLFLNLEITGYGFIGITSKINEVQKNMPDILIERPTIEDI
FT                   MLAYIERRE"
FT   CDS             699164..699802
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0576"
FT                   /product="putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02469"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ29"
FT                   /protein_id="CBE02469.1"
FT                   /translation="MLIHLVKKDILIVKKYVLLILFIAIGIPLFILWRLPPFAQILGFV
FT                   LSIIFSEFMLCQYLLLKESQYSKASVLLCSTPYPRRGLVQSKYVLFAMVFIYCTLVYWI
FT                   ENLLIPQIGTFDLTYILIVLLISSIIYGVYMPIQYKLGYETTKFFFVMIIMASSFVLPL
FT                   TIAHSNFEIPFIYQYPSMIVNIVLFLLSLIILLASMFISIKIFSNKELV"
FT   CDS             700776..701510
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0577"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02470"
FT                   /db_xref="GOA:C9YJ30"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ30"
FT                   /protein_id="CBE02470.1"
FT                   /translation="MNLAKGLDVLKISSNVFGEDKVMYIPVIYTEDDATLIDTGLPGQG
FT                   DLIIDALNKSNTSFDRLKNIIITHHDIDHIGNINYLREKSKNNIKVYAYKSEVSYITGE
FT                   ETPFKLYMLEQMVDKIDDKMLSMLNVMVLGFKSSYTKVDVSLDNHEKLNLGEEIEVIHT
FT                   GGHTRGHICLYLKESKVLIAGDLLQVENGELTPVDVMHSNKQELKDAIKNISNYDIETI
FT                   VFSHGGLYQRDIIGTLKNLIIE"
FT   CDS             702652..703908
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0578"
FT                   /product="putative chloride ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02472"
FT                   /db_xref="GOA:C9YJ31"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ31"
FT                   /protein_id="CBE02472.1"
FT                   /translation="MIEKFKTLIWIKMIIRIKSVYKTYGGLFLLGLIGIPVGAIIGLID
FT                   TIFGTVLLKVTDIRETYPMYLIPFLAVVGVVIAYCYFKFGGKSSKGMNLIFEVGHGEEE
FT                   IIPLRLVPFIISGTWLTHLFGGSAGREGVAVQIGATFSHWVGKRLPIKNASSIFLVTGI
FT                   AAGFAGLFETPIAAILFAMEVLVAGSLEYQSLFPAFTASFTASAVSKTLGLEKFSFALS
FT                   SKVVFDLPIFWKLIVLGIIFGMVGGAFAWCLKLSKRKIGNRLKNPMIRIAIIGVCLSVL
FT                   FLLFYKGRYSGLGTNLIQNSFYGGEIYSFDWLLKFILTILTLSAGFQGGEVTPLFSIGA
FT                   SLGVLLAGFFNLPIELVAALGYASVFGSATNTFFAPVFIGAEVFGYSYLPYFFVVCAIS
FT                   YIFNMDKSIYSLQKISTKQ"
FT   CDS             703971..705164
FT                   /transl_table=11
FT                   /gene="u2"
FT                   /locus_tag="CDR20291_0579"
FT                   /product="putative Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02474"
FT                   /db_xref="GOA:C9YJ32"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ32"
FT                   /protein_id="CBE02474.1"
FT                   /translation="MLTSLALIFLLGMASGGIFEKIKLPSLLGMLLTGIILGSYVLNLI
FT                   DNSILDISSDLRKIALIIILTRAGLSLDINDLKKVGRPAVLMCFIPATFEIIGMIVLAP
FT                   KLLGVSILEAAVMGAVVGAVSPAIIVPKMLKLMEEGYGTEKSIPQMLLAGTSIDDIFVI
FT                   VMFTVFTGLAQGNSISAISFLQIPVSIILGVIVGAVIGICLAVFFKKVHMRDSAKGVLL
FT                   LSISFLMISLETALEGIVPFSGLLAVMNIGIFLQIKYRVVARRLSVKYSKLWVGAEILL
FT                   FVLVGATVDISYAFKAGIGAVILIFGVLLFRMVGVFFCLIKTNLTIKERLFCMIGYIPK
FT                   ATVQAAIGGVPLAMGIASGQLILTLAVLAILITAPLGAFGIDVTYKKLLTSVEGKSK"
FT   CDS             705371..705751
FT                   /transl_table=11
FT                   /gene="u1"
FT                   /locus_tag="CDR20291_0580"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02476"
FT                   /db_xref="GOA:C9YJ33"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ33"
FT                   /protein_id="CBE02476.1"
FT                   /translation="MYLKKLSKLELVIMKFIWNLDIKTNSYEIIDYMKEEHNLPEKVAL
FT                   KILSKLSKKRFLYVQETGKCMYYTVAIKEKTYLEFISRNVQNLLKNNFIRNLLVSFHEE
FT                   ELTEEKIKSLENWVVNWEEAYI"
FT   CDS             706660..707214
FT                   /transl_table=11
FT                   /gene="tcdD"
FT                   /locus_tag="CDR20291_0581"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02477"
FT                   /db_xref="GOA:C9YJ34"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ34"
FT                   /protein_id="CBE02477.1"
FT                   /translation="MQKSFYELIVLARNNSVDDLQEILFMFKPLVKKLSRVLHYEEGET
FT                   DLIIFFIELIKNIKLSSFSEKSDAIIVKYIHKSLLNKTFELSRRYSKMKFNFVEFDENI
FT                   LNMKNNYQSKSVFEEDICFFEYILKELSGIQRKVIFYKYLKGYSDREISVKLKISRQAV
FT                   NKAKNRAFKKIKKDYENYFNL"
FT   CDS             707545..714645
FT                   /transl_table=11
FT                   /gene="tcdB"
FT                   /locus_tag="CDR20291_0582"
FT                   /product="toxin B"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02479"
FT                   /db_xref="GOA:C9YJ35"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR020974"
FT                   /db_xref="InterPro:IPR024769"
FT                   /db_xref="InterPro:IPR024770"
FT                   /db_xref="InterPro:IPR024772"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ35"
FT                   /protein_id="CBE02479.1"
FT                   /translation="MSLVNRKQLEKMANVRFRVQEDEYVAILDALEEYHNMSENTVVEK
FT                   YLKLKDINSLTDIYIDTYKKSGRNKALKKFKEYLVTEVLELKNNNLTPVEKNLHFVWIG
FT                   GQINDTAINYINQWKDVNSDYNVNVFYDSNAFLINTLKKTIVESATNDTLESFRENLND
FT                   PRFDYNKFYRKRMEIIYDKQKNFINYYKTQREENPDLIIDDIVKIYLSNEYSKDIDELN
FT                   SYIEESLNKVTENSGNDVRNFEEFKGGESFKLYEQELVERWNLAAASDILRISALKEVG
FT                   GVYLDVDMLPGIQPDLFESIEKPSSVTVDFWEMVKLEAIMKYKEYIPGYTSEHFDMLDE
FT                   EVQSSFESVLASKSDKSEIFSSLGDMEASPLEVKIAFNSKGIINQGLISVKDSYCSNLI
FT                   VKQIENRYKILNNSLNPAISEDNDFNTTTNAFIDSIMAEANADNGRFMMELGKYLRVGF
FT                   FPDVKTTINLSGPEAYAAAYQDLLMFKEGSMNIHLIEADLRNFEISKTNISQSTEQEMA
FT                   SLWSFDDARAKAQFEEYKKNYFEGSLGEDDNLDFSQNTVVDKEYLLEKISSLARSSERG
FT                   YIHYIVQLQGDKISYEAACNLFAKTPYDSVLFQKNIEDSEIAYYYNPGDGEIQEIDKYK
FT                   IPSIISDRPKIKLTFIGHGKDEFNTDIFAGLDVDSLSTEIETAIDLAKEDISPKSIEIN
FT                   LLGCNMFSYSVNVEETYPGKLLLRVKDKVSELMPSISQDSIIVSANQYEVRINSEGRRE
FT                   LLDHSGEWINKEESIIKDISSKEYISFNPKENKIIVKSKNLPELSTLLQEIRNNSNSSD
FT                   IELEEKVMLAECEINVISNIDTQVVEGRIEEAKSLTSDSINYIKNEFKLIESISDALYD
FT                   LKQQNELEESHFISFEDILETDEGFSIRFIDKETGESIFVETEKAIFSEYANHITEEIS
FT                   KIKGTIFDTVNGKLVKKVNLDATHEVNTLNAAFFIQSLIEYNSSKESLSNLSVAMKVQV
FT                   YAQLFSTGLNTITDAAKVVELVSTALDETIDLLPTLSEGLPVIATIIDGVSLGAAIKEL
FT                   SETSDPLLRQEIEAKIGIMAVNLTAATTAIITSSLGIASGFSILLVPLAGISAGIPSLV
FT                   NNELILRDKATKVVDYFSHISLAESEGAFTSLDDKIMMPQDDLVISEIDFNNNSITLGK
FT                   CEIWRMEGGSGHTVTDDIDHFFSAPSITYREPHLSIYDVLEVQKEELDLSKDLMVLPNA
FT                   PNRVFAWETGWTPGLRSLENDGTKLLDRIRDNYEGEFYWRYFAFIADALITTLKPRYED
FT                   TNIRINLDSNTRSFIVPVITTEYIREKLSYSFYGSGGTYALSLSQYNMNINIELNENDT
FT                   WVIDVDNVVRDVTIESDKIKKGDLIENILSKLSIEDNKIILDNHEINFSGTLNGGNGFV
FT                   SLTFSILEGINAVIEVDLLSKSYKVLISGELKTLMANSNSVQQKIDYIGLNSELQKNIP
FT                   YSFMDDKGKENGFINCSTKEGLFVSELSDVVLISKVYMDNSKPLFGYCSNDLKDVKVIT
FT                   KDDVIILTGYYLKDDIKISLSFTIQDENTIKLNGVYLDENGVAEILKFMNKKGSTNTSD
FT                   SLMSFLESMNIKSIFINSLQSNTKLILDTNFIISGTTSIGQFEFICDKDNNIQPYFIKF
FT                   NTLETKYTLYVGNRQNMIVEPNYDLDDSGDISSTVINFSQKYLYGIDSCVNKVIISPNI
FT                   YTDEINITPIYEANNTYPEVIVLDTNYISEKINININDLSIRYVWSNDGSDFILMSTDE
FT                   ENKVSQVKIRFTNVFKGNTISDKISFNFSDKQDVSINKVISTFTPSYYVEGLLNYDLGL
FT                   ISLYNEKFYINNFGMMVSGLVYINDSLYYFKPPIKNLITGFTTIGDDKYYFNPDNGGAA
FT                   SVGETIIDGKNYYFSQNGVLQTGVFSTEDGFKYFAPADTLDENLEGEAIDFTGKLTIDE
FT                   NVYYFGDNYRAAIEWQTLDDEVYYFSTDTGRAFKGLNQIGDDKFYFNSDGIMQKGFVNI
FT                   NDKTFYFDDSGVMKSGYTEIDGKYFYFAENGEMQIGVFNTADGFKYFAHHDEDLGNEEG
FT                   EALSYSGILNFNNKIYYFDDSFTAVVGWKDLEDGSKYYFDEDTAEAYIGISIINDGKYY
FT                   FNDSGIMQIGFVTINNEVFYFSDSGIVESGMQNIDDNYFYIDENGLVQIGVFDTSDGYK
FT                   YFAPANTVNDNIYGQAVEYSGLVRVGEDVYYFGETYTIETGWIYDMENESDKYYFDPET
FT                   KKAYKGINVIDDIKYYFDENGIMRTGLITFEDNHYYFNEDGIMQYGYLNIEDKTFYFSE
FT                   DGIMQIGVFNTPDGFKYFAHQNTLDENFEGESINYTGWLDLDEKRYYFTDEYIAATGSV
FT                   IIDGEEYYFDPDTAQLVISE"
FT   CDS             714767..715267
FT                   /transl_table=11
FT                   /gene="tcdE"
FT                   /locus_tag="CDR20291_0583"
FT                   /product="putative cell wall hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02481"
FT                   /db_xref="GOA:C9YJ36"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ36"
FT                   /protein_id="CBE02481.1"
FT                   /translation="MHSSSPFYISNGNKIFFYINLGGVMNMTISFLSEHIFIKLVILTI
FT                   SFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCI
FT                   NFLRLKHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKIAVLLDAMTDEMNAK
FT                   DEK"
FT   CDS             715995..724127
FT                   /transl_table=11
FT                   /gene="tcdA"
FT                   /locus_tag="CDR20291_0584"
FT                   /product="toxin A"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02483"
FT                   /db_xref="GOA:C9YJ37"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR020974"
FT                   /db_xref="InterPro:IPR024769"
FT                   /db_xref="InterPro:IPR024770"
FT                   /db_xref="InterPro:IPR024772"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ37"
FT                   /protein_id="CBE02483.1"
FT                   /translation="MSLISKEELIKLAYSIRPRENEYKTILTNLDEYNKLTTNNNENKY
FT                   LQLKKLNESIDVFMNKYKNSSRNRALSNLKKDILKEVILIKNSNTSPVEKNLHFVWIGG
FT                   EVSDIALEYIKQWADINAEYNIKLWYDSEAFLVNTLKKAIVESSTTEALQLLEEEIQNP
FT                   QFDNMKFYKKRMEFIYDRQKRFINYYKSQINKPTVPTIDDIIKSHLVSEYNRDETLLES
FT                   YRTNSLRKINSNHGIDIRANSLFTEQELLNIYSQELLNRGNLAAASDIVRLLALKNFGG
FT                   VYLDVDMLPGIHSDLFKTIPRPSSIGLDRWEMIKLEAIMKYKKYINNYTSENFDKLDQQ
FT                   LKDNFKLIIESKSEKSEIFSKLENLNVSDLEIKIAFALGSVINQALISKQGSYLTNLVI
FT                   EQVKNRYQFLNQHLNPAIESDNNFTDTTKIFHDSLFNSATAENSMFLTKIAPYLQVGFM
FT                   PEARSTISLSGPGAYASAYYDFINLQENTIEKTLKASDLIEFKFPENNLSQLTEQEINS
FT                   LWSFDQASAKYQFEKYVRDYTGGSLSEDNGVDFNKNTALDKNYLLNNKIPSNNVEEAGS
FT                   KNYVHYIIQLQGDDISYEATCNLFSKNPKNSIIIQRNMNESAKSYFLSDDGESILELNK
FT                   YRIPERLKNKEKVKVTFIGHGKDEFNTSEFARLSVDSLSNEISSFLDTIKLDISPKNVE
FT                   VNLLGCNMFSYDFNVEETYPGKLLLSIMDKITSTLPDVNKDSITIGANQYEVRINSEGR
FT                   KELLAHSGKWINKEEAIMSDLSSKEYIFFDSIDNKLKAKSKNIPGLASISEDIKTLLLD
FT                   ASVSPDTKFILNNLKLNIESSIGDYIYYEKLEPVKNIIHNSIDDLIDEFNLLENVSDEL
FT                   YELKKLNNLDEKYLISFEDISKNNSTYSVRFINKSNGESVYVETEKEIFSKYSEHITKE
FT                   ISTIKNSIITDVNGNLLDNIQLDHTSQVNTLNAAFFIQSLIDYSSNKDVLNDLSTSVKV
FT                   QLYAQLFSTGLNTIYDSIQLVNLISNAVNDTINVLPTITEGIPIVSTILDGINLGAAIK
FT                   ELLDEHDPLLKKELEAKVGVLAINMSLSIAATVASIVGIGAEVTIFLLPIAGISAGIPS
FT                   LVNNELILHDKATSVVNYFNHLSESKEYGPLKTEDDKILVPIDDLVISEIDFNNNSIKL
FT                   GTCNILAMEGGSGHTVTGNIDHFFSSPYISSHIPSLSVYSAIGIKTENLDFSKKIMMLP
FT                   NAPSRVFWWETGAVPGLRSLENNGTKLLDSIRDLYPGKFYWRFYAFFDYAITTLKPVYE
FT                   DTNTKIKLDKDTRNFIMPTITTDEIRNKLSYSFDGAGGTYSLLLSSYPISMNINLSKDD
FT                   LWIFNIDNEVREISIENGTIKKGNLIEDVLSKIDINKNKLIIGNQTIDFSGDIDNKDRY
FT                   IFLTCELDDKISLIIEINLVAKSYSLLLSGDKNYLISNLSNTIEKINTLGLDSKNIAYN
FT                   YTDESNNKYFGAISKTSQKSIIHYKKDSKNILEFYNGSTLEFNSKDFIAEDINVFMKDD
FT                   INTITGKYYVDNNTDKSIDFSISLVSKNQVKVNGLYLNESVYSSYLDFVKNSDGHHNTS
FT                   NFMNLFLNNISFWKLFGFENINFVIDKYFTLVGKTNLGYVEFICDNNKNIDIYFGEWKT
FT                   SSSKSTIFSGNGRNVVVEPIYNPDTGEDISTSLDFSYEPLYGIDRYINKVLIAPDLYTS
FT                   LININTNYYSNEYYPEIIVLNPNTFHKKVNINLDSSSFEYKWSTEGSDFILVRYLEESN
FT                   KKILQKIRIKGILSNTQSFNKMSIDFKDIKKLSLGYIMSNFKSFNSENELDRDHLGFKI
FT                   IDNKTYYYDEDSKLVKGLININNSLFYFDPIESNLVTGWQTINGKKYYFDINTGAASTS
FT                   YKIINGKHFYFNNNGVMQLGVFKGPDGFEYFAPANTQNNNIEGQAIVYQSKFLTLNGKK
FT                   YYFDNDSKAVTGWRIINNEKYYFNPNNAIAAVGLQVIDNNKYYFNPDTAIISKGWQTVN
FT                   GSRYYFDTDTAIAFNGYKTIDGKHFYFDSDCVVKIGVFSGSNGFEYFAPANTYNNNIEG
FT                   QAIVYQSKFLTLNGKKYYFDNNSKAVTGWQTIDSKKYYFNTNTAEAATGWQTIDGKKYY
FT                   FNTNTAEAATGWQTIDGKKYYFNTNTSIASTGYTIINGKYFYFNTDGIMQIGVFKVPNG
FT                   FEYFAPANTHNNNIEGQAILYQNKFLTLNGKKYYFGSDSKAITGWQTIDGKKYYFNPNN
FT                   AIAATHLCTINNDKYYFSYDGILQNGYITIERNNFYFDANNESKMVTGVFKGPNGFEYF
FT                   APANTHNNNIEGQAIVYQNKFLTLNGKKYYFDNDSKAVTGWQTIDSKKYYFNLNTAVAV
FT                   TGWQTIDGEKYYFNLNTAEAATGWQTIDGKRYYFNTNTYIASTGYTIINGKHFYFNTDG
FT                   IMQIGVFKGPDGFEYFAPANTHNNNIEGQAILYQNKFLTLNGKKYYFGSDSKAVTGLRT
FT                   IDGKKYYFNTNTAVAVTGWQTINGKKYYFNTNTYIASTGYTIISGKHFYFNTDGIMQIG
FT                   VFKGPDGFEYFAPANTDANNIEGQAIRYQNRFLYLHDNIYYFGNDSKAATGWATIDGNR
FT                   YYFEPNTAMGANGYKTIDNKNFYFRNGLPQIGVFKGPNGFEYFAPANTDANNIDGQAIR
FT                   YQNRFLHLLGKIYYFGNNSKAVTGWQTINSKVYYFMPDTAMAAAGGLFEIDGVIYFFGV
FT                   DGVKAPGIYG"
FT   CDS             complement(724462..725022)
FT                   /transl_table=11
FT                   /gene="dtxA"
FT                   /locus_tag="CDR20291_0585"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02484"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ38"
FT                   /protein_id="CBE02484.1"
FT                   /translation="MFFGNISSPACSEDHEEVISNQTSVIDSQKTEIETLNSKLSDAEP
FT                   WFKMKDDEKKAIEAENQRKAEEAKKAEEQRKKEEEEKKGYDTGITYDQLARTPDDYKYK
FT                   KVKFEGKVIQVIEDGDEVQIRLAVSGNYDKVVLCSYKKSITPSRVLEDDYITIRGISAG
FT                   TITYESTMGGKITIPGIAVEKIN"
FT   CDS             725559..725804
FT                   /transl_table=11
FT                   /gene="d1"
FT                   /locus_tag="CDR20291_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02486"
FT                   /db_xref="GOA:C9YJ39"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR021725"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ39"
FT                   /protein_id="CBE02486.1"
FT                   /translation="MGELQKIPGVGKATEKSLIMLGYTTIKSLKDANPAQMYEKECLMR
FT                   GQHIDRCQLYVYRCAVYFASTENPEPEKLKWWYWKD"
FT   CDS             complement(726021..726290)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02488"
FT                   /db_xref="InterPro:IPR024227"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ40"
FT                   /protein_id="CBE02488.1"
FT                   /translation="MFESRCGVCCDSCTKKEQVNCTGCPTMEKPFWGGECKVKTCCESK
FT                   ELNHCGECDTFPCDMLLNKGKDQGFDPMVNIGQCRKWLEETVSN"
FT   CDS             complement(727324..728061)
FT                   /transl_table=11
FT                   /gene="d2"
FT                   /locus_tag="CDR20291_0588"
FT                   /product="putative lantibiotic ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02490"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ41"
FT                   /protein_id="CBE02490.1"
FT                   /translation="MLRKSVLGEILKLKNSFIWYVLLALPLISVLIGSGNFYLNQGILK
FT                   KEWYSLWTQVSLFYGEFFFPILIAIFCAYICRLEHMNHNWNNVMTLPVNLKNIFLSKLT
FT                   VVSILTAITQVFFVIFYIVAGNMFGFSGSVPKELTGWIAKGWIISISIASIQLYMSIKI
FT                   RSFATPIGISLCLSLFGMGLIVAKPAVGIFFPYSMLGSAMGVIKQSALNVNDTIVTICV
FT                   AFITTIVFSEIANRNFRKNDVIS"
FT   CDS             complement(728073..728834)
FT                   /transl_table=11
FT                   /gene="d3"
FT                   /locus_tag="CDR20291_0589"
FT                   /product="putative lantibiotic ABC transporter, peremase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02491"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ42"
FT                   /protein_id="CBE02491.1"
FT                   /translation="MKYLGLEFYKLKRKKIILMTFLFVAVEIMWCIVNSNRAITRNPDM
FT                   LGGFEYSYMLMSFASLNGLFFPILISIITSRISDIEHKGDTWKLLKSSVTSLNSIYLSK
FT                   FLCSAILVSIPILMQVLSIVLFGHFRGVIESISVSLLLKYTLGTILVSIAIIALHLWIA
FT                   TVIPNQMIAITFGMIGSFIGLTSGLFYQGIRRLFIWSYYLELSPLSYAYDNVLGSSVYR
FT                   IDMNFSITILVFLIGMLIYYIGRNHLLKKEV"
FT   CDS             complement(728834..729757)
FT                   /transl_table=11
FT                   /gene="d4"
FT                   /locus_tag="CDR20291_0590"
FT                   /product="putative lantibiotic ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02493"
FT                   /db_xref="GOA:C9YJ43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ43"
FT                   /protein_id="CBE02493.1"
FT                   /translation="MKHMEMIIRTQRLSKEYNKIFRVKDIDLRVPQGAVYGFLGPNGAG
FT                   KSTTLKMLLGLAKPTQGNINILGKELNEKNRISILKDIGSLIESPSYYGHLTGLENMTI
FT                   MQRLLDLPKKNVNEALKIVRLENQKNKKVNQYSLGMKQRLGIAMAIMKFPKLLILDEPT
FT                   NGLDPAGIEEIRELIKSLPEKYGMTVLISSHLLSEIDQIATSIGIINHGELVFQDSIKE
FT                   LHNRGQSQIAIKAKNVVSAQKLLNTKGYMSLIQNGYLTIENLKDSDVAKINGMLVHSNI
FT                   DVFRIEEHKKSLEDIFLELTGKAVTL"
FT   CDS             729913..730626
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0591"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02495"
FT                   /db_xref="GOA:C9YJ44"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ44"
FT                   /protein_id="CBE02495.1"
FT                   /translation="MIMESIKDKKILVVDDHKELLKMIDEILRKEGFSRVFLASSYEEA
FT                   VRVFRNVKPDCAILDVVLPDGDGFSIMRKIRETSKIPVIFLSARGEDEDRLIGLGLGAD
FT                   DYIVKPFLPKELTLRLVGILNRVYVPIEEEELPVFKLGDSVVVNLNSACVEKDGQEISL
FT                   TAKEHSLLLKLYENKGRIVTNDSLCQAIWGDDMYGYENTLMVHVRRVREKIEKTPSTPK
FT                   HLITVRGLGYKLMIN"
FT   CDS             730671..732077
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0592"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02497"
FT                   /db_xref="GOA:C9YJ45"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ45"
FT                   /protein_id="CBE02497.1"
FT                   /translation="MDSVKYILRRFIGSSILISLLFIVLNIAGFLLFSYMLFVSKYSDN
FT                   LDTSDSREIKSNLIMIEDNLILKDGKFILDDSSKEVLHKNKVWAMLIDNNGDRIWGFDL
FT                   PKEIPSHYTLTDVAKFSRFFLKDYPVYVWEHPNGILVTGYPKDKYTKFNLTYTIKEIEQ
FT                   FPMLIIGMFLVNAIVTFLIALFIGLKMVKSIKPIITGIKLMSKGEPVLLQEKGILSDIS
FT                   KSINTVSKELQMKDEKLRKKEEARSNWIAGISHDIRTPLSMIIGYAGELEESSSLSNRE
FT                   QEQVSIICNQGVKIRELVNDLNLVSKLEYNMQALNCDKIRVSAFLRELISEFINNNLDN
FT                   DFYVELDILNEDIIIDADKKLLKRAISNLIQNSITHNQQGCNIRVTSKSDLDFCYIIVE
FT                   DDGKGMSQERINSLLKSQNGLSEAYAKGQNHGLGILIVAGIINAHRGKLDIMSIDSQGL
FT                   KTILKLPLIK"
FT   CDS             733666..734055
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0593"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02499"
FT                   /db_xref="GOA:C9YJ46"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ46"
FT                   /protein_id="CBE02499.1"
FT                   /translation="MTIKKLPQSELKIMKFIWKSDSKVTSRDIVLGMEQKYQWKQTTTL
FT                   TLLSRLVVKRFLNSQKIDKYTHYEVLIKEKEYIGVETRDFFRNIHDSSIKSLLLSLHEN
FT                   INLSKDDILLIEEWIKNLKEEEKDV"
FT   CDS             734800..735270
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0594"
FT                   /product="putative glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02501"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ47"
FT                   /protein_id="CBE02501.1"
FT                   /translation="MKYQVSLLAVKDIEVSKKFYKELFEQEIELDLGKNVTFKGGFAIQ
FT                   EDFAWLTGINPDTIIQKSNNMELYFEVDDFDEFIEKLNYYKDVEFVHKPLKHEWQQRVV
FT                   RIYDPDKHIIEIGESMEVIARRYLSEGYSVEETSKIIQHPIEFVKQCENSKE"
FT   CDS             join(735647..735700,735701..736432)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0595"
FT                   /product="putative uncharacterized protein (pseudogene)"
FT   CDS             737338..738045
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02503"
FT                   /db_xref="GOA:C9YJ48"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ48"
FT                   /protein_id="CBE02503.1"
FT                   /translation="MIFTKSNKYDKDFLMKNMMGPNCIKILEELTSKIKLEKGMRILDL
FT                   GCGKGISSIFLAKEFDATVFATDLWIEPTENYKRFKEFKLDDKIFPIQAEAHELPYAEG
FT                   FFDAVISIDSYHYFGNKEGFLDNHISPLVKEGGILAMAMPGLKEDFVDCIPDELIPFWQ
FT                   DNMNFHSITWWNKLWSESESVIVEKCEALNCHDEAWKDWINCDNSYAINDKKMMEVENG
FT                   KYFNTISLIARTK"
FT   CDS             738225..738440
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0597"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02505"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ49"
FT                   /protein_id="CBE02505.1"
FT                   /translation="MGIFIFLKLNCKYYCVIYILILNVCFIRNKLIEKIVLTMKAKKVL
FT                   MKIKNFIVPFYIFFYIFYYTLNQISK"
FT   CDS             738657..739157
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0598"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02507"
FT                   /db_xref="GOA:C9YJ50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ50"
FT                   /protein_id="CBE02507.1"
FT                   /translation="MIEGIKFIKAEEKYIYSYWQTFDKIAKERKYLAMDEAFPFEETVE
FT                   FIKNTINKNLPQLFIIDLESDNCIGWCDVLPKTEKVGYLGMGILKEYREKGIGSSLLKQ
FT                   IIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDRPVKEEVIQMEL
FT                   TLI"
FT   CDS             complement(739407..740186)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02509"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ51"
FT                   /protein_id="CBE02509.1"
FT                   /translation="MNKNILNNSFPEVPESFHNSLSKTLNSLPEREENYKMINNKTHKL
FT                   PFRKGLVATLAITLILSTTALAVGHIYSLVGKSSTKATYTSIPTTEQVKKDFNFTPNIV
FT                   SEFSNGYKFKGAYTVNKKALDKENNVLGKSKALSFEYKNGNDEISLDTANNVLEKSSDN
FT                   LKVVDTYKDINISYEAFAQKFVPEGYKMTEQDKIDEKSGKYTFSVGPNNESDKVEVNEF
FT                   KFLTWKQDGVYYSFTVQDSNLSMNDLVKMAHEVIDAK"
FT   CDS             complement(740183..740686)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0600"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02511"
FT                   /db_xref="GOA:C9YJ52"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ52"
FT                   /protein_id="CBE02511.1"
FT                   /translation="MHRREGTQLDKTTFTNNILESEQTLYRVSKSILGNDQDCEDAVNN
FT                   AILKAYEKLDSLKEEQYFKTWLIRIVINECNSLRRKRLKSLSFEDVFKNKKIDEKDDYS
FT                   DLYTAIQSLPKKIKIPIVLYYIEGYSVDEVKEILDIPQGTVKSRLSRGRTLLKTKLENT
FT                   EVII"
FT   CDS             741468..742169
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0601"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02512"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ53"
FT                   /protein_id="CBE02512.1"
FT                   /translation="MKFQEMINSPGLWIVSSFLVIISVVQAIVFMKSALKEASNLGIER
FT                   KGIKAAIRSASVTAIGPSLSPVITLLSLVAVIGAPTTWMRLCDVGAARTELGVISLTSN
FT                   LSGVEVGSAAFGAEAFSYALWGMALNNLGWLLVVFILGHRMRGIVEKMNVKYNPTWVKK
FT                   LLAGATVGLFAYLLSNQIKTFEIPKLTPAVISAIVMLVLTTLFKKNQRLQELSLGIAML
FT                   IGMFGTQIVLS"
FT   CDS             742195..742851
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0602"
FT                   /product="putative membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02514"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ54"
FT                   /protein_id="CBE02514.1"
FT                   /translation="MYDKKMIKIGRISIGLAIIANFIPAIYVGLRFGQMPMLSVIFQIW
FT                   GLVATTYGVSWIVQPIAYYPTLGAPGSYIGWLAGSVGDIRMPAASMAQKIAGVEAGTHE
FT                   GEVVGTIGTCCSIFVSASMITIFTIVGYKVIPLLPEFITDSFNYILPALFGAIYVDIAR
FT                   KDIRAGGCTIAVALAIMYFGEKIGIPGGLLTLFIVLGGILITRVFFVIDSNKTKE"
FT   CDS             743058..744698
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0603"
FT                   /product="amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02516"
FT                   /db_xref="GOA:C9YJ55"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012855"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ55"
FT                   /protein_id="CBE02516.1"
FT                   /translation="MFDVKIANGIIIDGTGNSRYKGDVGIVGDKIMAIGDLSQKEAKET
FT                   IDATGKFVSPGFIDFHTHSDLSLVYDKYTRSRIHTGVTTDVIANCGIGVAPIREEKKQE
FT                   LIDYLGTRIIGTIPIKLNLHWNTMQEYFDYLTENSPAVNVVAYVAQGPVRINEMGFSKE
FT                   PATLEQLKNMKLEVRKAMEAGCVALSSGLVYLPGAYTKKEEMAELCKELIPYNGYYISH
FT                   IRDEGDEEMEALDEAIYIAKTAGVPLHISHLKVMGHKNFGTIDKVFKKLDEAEADGLEV
FT                   TFDCYPYTAGMTSLGALLPPWAFEGGVENMVKRLEVQENRDRIIKELEEGIPGWQCFYQ
FT                   LAGGWDGVVLASVMTEANKYVEGKTLMEVAKINGENPFDTFFRLLIEEKSKIQVVVHTQ
FT                   GQEDTDKVVCHPKSCIGSDSMDLSTEGLLSLGKPHPRAFGTFGRIFSYYVREKGMLTFE
FT                   EAVKKITYLSAKRLGIYKERGLLKENYFADIVVFDPDTIEDKATYSNPKQYTVGVEYVL
FT                   VNGKIALAGGKQTDVCAGRVIKNPLSIAK"
FT   CDS             745057..746379
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0604"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02518"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ56"
FT                   /protein_id="CBE02518.1"
FT                   /translation="MKILYVGPGMVIDKILAVSKKNFPNIEADFLRYDRYIEVPDLLEK
FT                   YRGRVDAVLFTGKSPFKFFEKRQKDFVLSDYIPRHETTLYRVLLEITYLLKFDISRLSI
FT                   DTYDKAMLKRLYKEIGVEFKDEHMFFAEQKYLEEDYIKFVLEFHKYNYQNNDICCCITG
FT                   LEEAYHAMKKENIPVVLALPSEDVMVQSIKNIQMRYIAKKNNENQIVVLAIKLNMPSEY
FT                   SLMKEDEYAYLSQRIKILDKLYHFNSRIDGVLVEQSRSEFMIFTTKKILELETKKYRDI
FT                   YLLDMIREVSVINTYIGIGYGKTANEAKFNAYESIKMAQSQKNDAAYVVFENGEIMGPL
FT                   KPNPAVKEKNSFDERFYQIATETGLSANTVYKVFNKIINSGKTEFTSKELAIICGVSIR
FT                   TMDRIILRLCDSGYCEVVSEQLMSKYGRPSRILRFKPFLLF"
FT   CDS             746576..747583
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02520"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ57"
FT                   /protein_id="CBE02520.1"
FT                   /translation="MGKYQDSKKVVRNYFEALENATGDEVENVLKQHMKSDYNWKGVYP
FT                   FREQEGTENVADVFWKPLKKSLSNMQRRQDIFIAGTNEIDNSEWVMSMGHFMGLFDKDW
FT                   LGIKHTRKMISLRYAEFNCVQDGKIAKTGLFVDIIGFMIQAGVNPLPPQTGSYFVYPGP
FT                   IDHNGLLFEDADEVEGVKTLALVNKMVDDLSELNESGTMGCPPEILKKSWAKDMIWYGP
FT                   GGIGASYTIPRYQEQHQLPFRNNLKGKTFNGHVCRFAEGNFACFFGWPNLTNVPCGGFL
FT                   GLPGGEVKADMQVVDVYYRKGDKLQENWVLIDIPYWLKQQGLDILERTKSIFNA"
FT   CDS             747621..749018
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02522"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ58"
FT                   /protein_id="CBE02522.1"
FT                   /translation="MASTNKNNVTSKEEEKEVSTSGLESCTVKENKAKMNQTNFSNINE
FT                   NQTNENKTNTYKGNIDKINTNKSDINKVNIDTVDTDKLNTNTLTEKNKKVIFKGEDNMS
FT                   STKIYYGDSLEVTPVGVMDYNDFSKQTKREQEIPGFDSKYRDFVDYIMKITHNIWEEKG
FT                   IGVIYDTYHNNVTMHCGSSNLVGIKDVISNTLQTLHAFPDRRLIGQNVIWSNFGADGFL
FT                   SSHRVLSTATNLGDSNFGPATGRKINFRTVIDCATTNNRIHEEWLVRDNLWIVTQLGLN
FT                   PQEVAKSMAKASESKVLSLQSTYGICESMDGQFMPTKYQAKDDSVGEMMLEMTSRIYNY
FT                   KYINEVKKYYHDNAVVHFICDKDLNGYDEIQGMIVSLLASIPNGSYEVERVTCNQREKN
FT                   EGYDVSIRWRLRGINEGIGFFGQPSGKHIEVMGINHYHILQGKVKEEWITFDGMDVLKQ
FT                   MYMGVEE"
FT   CDS             749106..750428
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0607"
FT                   /product="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02524"
FT                   /db_xref="GOA:C9YJ59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ59"
FT                   /protein_id="CBE02524.1"
FT                   /translation="MFKLLAKIMTKFKRGNYKNMKTTVEIENDIILGKDYSNLKRGIAF
FT                   FSIALIYFFYCYNFMVGTFIKPTMIYALADGGFGFSLKQTEEIFAVMSFGTIPGTFIFG
FT                   VISTKIGKKRTLISVALLIGLTTFIPMLSPTDIMLWKIARLCTGVVLGGVFGTAMPLVA
FT                   DMFPSKYRGKLAAILTALFSLAMIFGGKVYGVLGDANWQILMYTAIIPPIVGAILAIFF
FT                   VPDDLEYTKELVKKGKETGEKISYISMYKGKYLWIGLGTILLSGANFTAYSAFSNNATT
FT                   YLVTGIGMSAAVAGSIYSLQGIGQLVGYLFWGSIADKFGRKIPFIGMALAAVFVFIYTK
FT                   LGGDNTTTFYMISVLLGVAVGYSGAWGAYYTELFPSKYRSLSSGMSFNGGRIISTFAIP
FT                   AIAGTASGTLGMMTIFYISIAVFVAGAIVWLFLPETLNNKK"
FT   CDS             join(750470..750697,750697..751509)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0608"
FT                   /product="putative sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02525"
FT                   /db_xref="GOA:C9YJ60"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ60"
FT                   /protein_id="CBE02525.1"
FT                   /translation="MISSIDVCIIIGYLLLMLVIGYYSGKDNKNQEDYFLAGRSMPWIP
FT                   IALSVAATMISANGFIGGPGWAYVDGMYPVMVKCAKNSFVVSAFVMNLVYYFMLLVGVI
FT                   LFVFYGGRTFETSNEIMITFILNELPVGAIGIIIAGVFAAAMSSIDSILNSMTTVFTKD
FT                   IYEFYFKKDNKESSLKVTMIITVVIGVVMTGFIIMGFGGSIKSILDLVGNYISYFAGPA
FT                   TGAFVLAMFTYKANDKGVSIGFIVGLVLGFFISNKYNVSWLWNPAIGATITLIFGYIFS
FT                   VILKKNHKVDDIKKYTAFGMRNHLISQGMDKVDGVSIVPFSLGKQELIVLAFFIIQYII
FT                   LFLIQF"
FT   CDS             751544..752566
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0609"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02527"
FT                   /db_xref="GOA:C9YJ61"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ61"
FT                   /protein_id="CBE02527.1"
FT                   /translation="MNQKKVHYNKSATSKDVARLAGVSQSSVSRAFGSANGKGVKPEVR
FT                   ERIFRVANEIGYVPNLVARGMISGKTNVIGLIVGDSLGPFYNRIINLFVEKIQEIGKQC
FT                   LVFKVPRQQSIDSIISKVIQFQVEAVIITASAMNKVMAETCEENNIPVILFNRFIPGIK
FT                   ISTVYVDPIEGGGMVAEYLLKKGHKNIGYIQFTRETSEEMEKKIGFYSKLRQSGIHNLK
FT                   EESANYDYDSGYEAGKRMLALSNPPTAIFCTSDLIAIGVMDAARFEYKLRVPEDLSVIG
FT                   YDDIQMASWKSYNLTTIRQPLDLLIEKTINILKSLLNEENPESVVEMLKPELIERGSTL
FT                   "
FT   CDS             complement(753176..754579)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0610"
FT                   /product="putative ATP-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02529"
FT                   /db_xref="GOA:C9YJ62"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ62"
FT                   /protein_id="CBE02529.1"
FT                   /translation="MKMLNNFFKKINNPAPVFAQTKMERDNQTDDSLSTKPKTTFRDVA
FT                   GLDEVKEELFEIVDFMKSPQKYQKMGAKIPKGVLFYGPPGTGKTLLASAVAGETNSSFF
FT                   NVTGSEFVEKYVGVGAKRVRTLFEKARKEAPSIIFIDEIDAVGAKRHLESNNEKDQTLN
FT                   QLLVEMDGFNKDSNVLIIGATNRLDLLDEALLRPGRFDRHIHIGAPNYHTRFEILKVHT
FT                   DDKPIDKSVNLELLAKKTHGFNGAHLSNIANEAAIFAVRDDSECITSEHFDKALERVIA
FT                   GLESKNSALVEKEKKIVAYHEAGHALVSDIVGICPIQKISIVPRGQALGYVLQLPDEDR
FT                   YIYTKDELIGKIKILLAGKASEELIFNHKSTGAKDDLKKVTEIANQMVCEYGMSNLGFM
FT                   TIDGNDKTFLCDKVQKEANRIVEICYKETLEMLKDNLEDLHSVSKFLFEKETMTHEELK
FT                   DLIGKEAVN"
FT   CDS             755540..755965
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="CDR20291_0611"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02531"
FT                   /db_xref="GOA:C9YJ63"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ63"
FT                   /protein_id="CBE02531.1"
FT                   /translation="MPTKEAQAMANSKNLDLVQISPNANPPVCKIMDYGKFRYEQARKE
FT                   KEAKKKQKTIVVKEVRLRPGIEQNDLNTKANNAIKFLKKGDKVKVELRFRGRELGHKDI
FT                   GKEVMLKFLDIIKEFGEPTKAPAFEGNNMVVIIDPKK"
FT   CDS             755993..756187
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="CDR20291_0612"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02532"
FT                   /db_xref="GOA:C9YJ64"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ64"
FT                   /protein_id="CBE02532.1"
FT                   /translation="MPKMKTHRGAAKRLKKTGTGKLKRAKAFKKHILTKKSAKTKMNLR
FT                   KSTLVSDGDAKRIAQLLPY"
FT   CDS             756243..756599
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="CDR20291_0613"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02533"
FT                   /db_xref="GOA:C9YJ65"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ65"
FT                   /protein_id="CBE02533.1"
FT                   /translation="MARVKKAMNARKKHKKILKLAKGFRGSRSKLYRPANTFVMKALKN
FT                   AYIGRKLKKRDFRKLWIQRINAAARMNGISYSRLMNGLKLSGIEVNRKMLSEMAIQDPE
FT                   GFAKLAEVAKAKLA"
FT   CDS             756909..757454
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02535"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ66"
FT                   /protein_id="CBE02535.1"
FT                   /translation="MNEKLMDCFVNPIKCKLLLEVFSNNRTTAKQLGEKFQDISKATLY
FT                   RYLNKMLKDDIIKVVEENKIRGTVEKVYAMKLDIADDVNKIIDENSGEEYAQLFTQYMM
FT                   GFLREFYEYAERKEKDILKEGSGFSVCPVYASIDEIVEVSKKIASILEPLRNNSHEEGR
FT                   RMHSIGVIITPPKEDEGK"
FT   CDS             757890..759815
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0615"
FT                   /product="putative nucleotide phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02536"
FT                   /db_xref="GOA:C9YJ67"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ67"
FT                   /protein_id="CBE02536.1"
FT                   /translation="MKIKFVIMPLVIFLIVLFVGCQSTKDTEVKAKDTEIKILGTGDLH
FT                   SILTDSMVSYVNEEREKNKNLLMVDAGDFYGTQSREMWEWSSGKKLINIKRNGRAEYDD
FT                   IIKSSKDEVPIVKDMAKLKYDAVVLGDNEFISNDKQSLDKLVSDFKNNNMPLVSANIYE
FT                   QSGENYVQPYVMKNIKTDEGNVKVGILGLTIKEVGETLGLEDFEKDKKARELGEQADYK
FT                   GKLYANDLVEDAKKWIKVMEKESPDIIVAVVHSGEEPKTDRNPGNRIKELATTVDGIDA
FT                   IVAGHTHEKIDEHKYKNKSGDEVIVTQPGWHGDRVSEINFKLNKENGKWDIKEKSSKLK
FT                   IIDKEVSIVATADLHSHFSDKLTVDLVNERSNPIEPVVVDAGDFLDPQTDEMTQWYKEW
FT                   KSIRDNNSDKTISRCPMVMDMNQGMYDAVVLGNHEFVSEKDEFWSDERLLDAVIEDFEQ
FT                   VAISVLSANIYRQSGKNYVKPYIIKDVETSEGNVKVGILGLTIKEVGKGLKNVNLQEQF
FT                   QYKDKLYANDLVEDAKKWVKVMKKKKPDIIVAVVHSGEEPKNPKHPGNRIKELATTVDG
FT                   IDAIVASHTHEKIDEHEYKNKSGEKVIVTQPGEHGKYYSKITFKVNKEKGSWIINDKFS
FT                   KTIEVE"
FT   CDS             760153..762120
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0616"
FT                   /product="putative nucleotide phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02538"
FT                   /db_xref="GOA:C9YJ68"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ68"
FT                   /protein_id="CBE02538.1"
FT                   /translation="MVKIKCDIKFYYHPKSKEESLMKIKFIIVASIIFLIVLLVGCQST
FT                   KDTEINVLATSDLHSIIPDNLISYVEEERKYDENLLMVDAGDFFDMQSGEMNKWFTGQK
FT                   LVRFKDGIPEYKKIAEPREGEVPLAKKMAKLKYDAVTFGNHEFVSNDKQSLDKLVSDFK
FT                   NNNIPLVSANVYEQSGENYVKPYVMKNINTDKGTVKVGILGLTIKEVGERSRFKSFKQD
FT                   KKARELGEQPQYKGKLYANDLVEDANKWVKVMEKKEKPDIIVAIVHSGEEPKNPKNPGN
FT                   RIKELATTVEGIDAIVAGHTHEKIEQHTYKNNSGEEVIVTQPGAHGNSISKINFKLDKK
FT                   NDKWFIKDKYSELKVFGKEVNIITTSGLNPKFSDEMAVNLFNERDRDVQPIFIDTGDFL
FT                   NTNTKEMTKWAKEWQYNENKGIYKKINEWPIVYLGYDAVVLGSHEFTEDKETFEGKKST
FT                   LDYIIENFEEMKIPVLSANIYDESGENYVKPYIIHNVETREGNIKVGVLGLTTTDKDEE
FT                   DLSSSSLSKDSKTSKIPEETGKLYTNNLVKDASEWVKVMQKESPDVIVAVVHSDNNSTL
FT                   KNPSSEVKKLAMSVDGIDAIVVGHTKNKVEEHIYKNKSGDEVIVTQSGEDCYSKISLEL
FT                   RKENGKWNIINKYSKAIKMK"
FT   CDS             762508..763287
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0617"
FT                   /product="putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02540"
FT                   /db_xref="GOA:C9YJ69"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ69"
FT                   /protein_id="CBE02540.1"
FT                   /translation="MNYKKIAIITGANSGFGKEFLKLLINEEEITEIWAVARNKARLNQ
FT                   LVDEFGSKVKVFSKDLSKIEEVKEIGTFLSKENVCIKYLINNAGFAKFCSYNDLSIDES
FT                   INMIDLNISAVVVLGLICIPYMQKGSHIMNISSQASFQPLPYQNIYSSTKAFIRNYTRA
FT                   LNVELKSKGINAIAVCPGWMSTNLFKRGIVVAEKGTKNFPGIVSPDVVAKKALKDAKKN
FT                   KDISVYGINTKSSHLLAKLLPQKMMMKVWLMQQHIKE"
FT   CDS             complement(763597..764472)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02542"
FT                   /db_xref="GOA:C9YJ70"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ70"
FT                   /protein_id="CBE02542.1"
FT                   /translation="MIVDYLYNLIFLEGGVITLKLKIVGSGGMSIIPSSFCKCKICEEA
FT                   RQKGGRYERLGPSLYIDDIKMLIDTPEDITVACNRQKISEVKHISISHHDPDHVKGIRI
FT                   VEKIGCDFITGENNPIGFYALPEVIEDINRTNLDCLKYYGDVINCISINETSHVKINNF
FT                   DIDLINNNPDRNITFYVIKENEKKVIYACCNPKPFTHSDMYFDADVLIISLVSDDGILN
FT                   DGTKLEDTPFKDEIFTLDEIVEIKNYYRIKKIIITHIDEMWGKSYGYYSELEKKLDNIY
FT                   FAYDGMEIIV"
FT   CDS             complement(765143..765961)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0619"
FT                   /product="MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02544"
FT                   /db_xref="GOA:C9YJ71"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ71"
FT                   /protein_id="CBE02544.1"
FT                   /translation="MFKIGDFSKLSKISIRMLRHYDEIGLLTPSHTNNTNGYRYYSADQ
FT                   LSTTNRIHALKDMGFGLYSIKEILTEYNDKESLIKYLNIHHSQVKEQLEDTQKKLLKIE
FT                   TTIKRIGGNDIMKNYDVTIKNFAPKYMMTLRRVIPTYQDEGMLWHQAFLETKDQNVQIE
FT                   PPKYSKAVFYDTGYKEDSVDVEVQVAVSGKYKDTEHVKFKTVPSVTAATAIVNGNFNQV
FT                   ADACEAIGNWISDNNYDVDGPMFNIYHVSPGNDSNPDNWVTEVCFPVKKK"
FT   CDS             766129..766710
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0620"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02546"
FT                   /db_xref="GOA:C9YJ72"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ72"
FT                   /protein_id="CBE02546.1"
FT                   /translation="MKSNDKDARERIIEVTLNLLNEVDDIEEITVRKIAERANVGVGLI
FT                   NYHFKTKDNLLSTAIGDVMSNIIAELYDDSVYTLRPIEDLKNLLKKLCDTGLHYEKVLP
FT                   FVLNQCITNGDMQAELDIVPMLRKIFGNKKDEMSLRIIALQIILPIQISALSTESFQLY
FT                   SGINIKNKYERDKFIDILIENIIGEDVDVR"
FT   CDS             complement(767065..768807)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0621"
FT                   /product="putative exported peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02547"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ73"
FT                   /protein_id="CBE02547.1"
FT                   /translation="MVKSKKKIFVFLILIAVFIIFASYIRNYTNDTKKDSVRGTIPFEK
FT                   MEYKRPNIQSICENINKCNDKLLTAKTAKEQLNLFNEVDKIYQDFYSTLTIAKIRNNID
FT                   SSDEFYSKEYKYLMSKSVDVDMSYKDFQDRFVTSKFSKELEKELGKDTFNYLKNIGKLN
FT                   SKEVEDLLKKEQDLVVKYEDLLAKSTVSIDGIEVDFEEALSRPNLSPEEYVKIYSDYLK
FT                   KYNPIFGNIFLELIQTRTEIASKQGFKNYIDYAYMNLNKDYSQEEAKKFRQDVKDYIVP
FT                   LYREISSKPSDSSIYIKVYKNRSFRKFDKVLEDISPKLKESFDYMKKYDLYDYSSGKNK
FT                   SPGGYTTYINKYKAPFLFNTWDNSFLGVTSFAHEFGHFYNYYNSINLNNKMQPSIDVCE
FT                   VHSTSLEILFYKYFDDFFGKQSEAIKKEHLSIVLNTIIDACLYDEFQEIIYKNPYMSLN
FT                   DINKLFFDLEEEYGVSNNILREKNAPFWILVSHNFQVPFYYLSYGLASDVSLQIWQLSQ
FT                   EDYRKAVDVYMDFLNQNTDAGFKDVVEKVNLQLPFQDGNLEEISSTLYDYFGIDNPLEL
FT                   KNAS"
FT   CDS             769278..770612
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0622"
FT                   /product="probable cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02549"
FT                   /db_xref="GOA:C9YJ74"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ74"
FT                   /protein_id="CBE02549.1"
FT                   /translation="MRPTQIMVSGFAAIIVIGALLLTLPIASQSGESIGLLNALFTATS
FT                   AVCVTGLVMVDTATYWSLFGQIVIITLIQIGGLGFMTVATMFSLMARKKIQLRERLLIQ
FT                   ESLNQADLSGLVRLTRFVLIITITIEGIGALVLSTVFIPQFGLSKGIWYSVFHAISAFC
FT                   NAGFDLMGSVSGPFTSLNSYVNNFTVSMTVCALIVLGGLGFPVVLDIVRKRRFSKLNVH
FT                   SKVVLFSTATLIFVGALFIFLIEFNQKATMADLPLKGKVLSAIFQSVTARTAGFNTLDL
FT                   ATLRESSVFVMIILMFIGASPASTGGGIKTTTLAVLIITVRSFLSGKSDIEAFERRLAP
FT                   STIKKSLGIFVISISAVIFGTLIISITQPNFTLVQSAFEVTSALATVGSSLAGTPNLNA
FT                   LGKIIIIIFMFMGRVGSLTLFMAILSGGRRKSQPIRYAEGKIMVG"
FT   CDS             770923..771594
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0623"
FT                   /product="putative cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02551"
FT                   /db_xref="GOA:C9YJ75"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ75"
FT                   /protein_id="CBE02551.1"
FT                   /translation="MKQYIVIGCGRFGSSVASTMHLLGHQVMAIDKNEDSVQSISDKVT
FT                   HSLIVDVTDEQALRSLGLGNFDVAVVAIGSDIRASIMATLIAKEMGVELIICKAKDELQ
FT                   AKVLYKIGADRVVFPERDMGVRVAHNLVSDNILDHIELDPEYSIVEIVTPNSWVGKTLI
FT                   ELELRARYEITVLAIKTGKNINVTPSPDEELTAGSILVIIGQNTSITAITSGNKGIIRR
FT                   R"
FT   CDS             771785..772582
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0624"
FT                   /product="putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02553"
FT                   /db_xref="GOA:C9YJ76"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ76"
FT                   /protein_id="CBE02553.1"
FT                   /translation="MITNINSKDNEKLKYTRALLKSKNRNKESKFIIEGYRIVMLALEC
FT                   MANLDYVFINEEFENKKEHVKLLEDLDKKNTKIYKTTNKNFKELVDTENTQGIIGVVSF
FT                   KKKKLSESINKKDKFVLILDRIQDPGNMGTIIRTADSAGVDAIIALKGCVDIYNPKVIR
FT                   STMGSIFDMNIIDASQDETVDMLKSLDFNIVSSYLNTENFYDKIDYGSKVALVIGNEAN
FT                   GINEELVSKSDILVKIPIYGKAESLNAAISSAILMYEIKKYLI"
FT   CDS             773201..774229
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="CDR20291_0625"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02554"
FT                   /db_xref="GOA:C9YJ77"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ77"
FT                   /protein_id="CBE02554.1"
FT                   /translation="MICVQEKLLALREAALAEIKEAQSIESVESLRVKYLGKKGEITAI
FT                   LKEMGKLSAEERPVVGKVANEVRENIELSINSKKEEINAIEKERKLKEEVIDVTQPGKV
FT                   LKVGKKHPITQIIDEVTDIFIGMGFSIAEGPEVETVENNFDALNAPKDHPSRDMSDTFY
FT                   INDGVLLRTQTSPVQVRTMRSQELPIKVIAPGRCFRSDSPDATHSPMFHQIEGLVVGKD
FT                   VTMAEFKGTMDIFVEKLFGSDIKTKFRPHNFPFTEPSAEVDVTCFKCGGKGCPMCKYEG
FT                   WIEILGSGMVHPNVLRNCGIDPEVYSGFAFGVGVERLAMLKYEIDDIRLLFENDMRFLN
FT                   QF"
FT   CDS             774246..776639
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="CDR20291_0626"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02556"
FT                   /db_xref="GOA:C9YJ78"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ78"
FT                   /protein_id="CBE02556.1"
FT                   /translation="MLVSLKWLRDYVDIDMDVKEFADKMTMTGTKVETIDYYGEEIENI
FT                   LVGKILEIKQHPNADKLVVTKVDIGDKVVQIVTGATNISEGDYIPVAVNGSKLPGGVEI
FT                   KQTDFRGELSDGMMCSAAELGIDEHYIEEYKRGGIYILDHEDSYELGKDIKDVLGLKDA
FT                   LIDFELTSNRPDCKCMMGIAREAAATIGTKVKYPEIEVKESDEEIDFKVEIDNPDLCRR
FT                   YVARMVTDVKIEPSPYWMQRRLTEAGVRPISNIVDITNFVMLELGQPLHAFDINQVETG
FT                   RIVVRNAKDGEKLVTLDDVERTLDKDMLVITNGEKSLGLAGVMGGANSEITSNTKTVLF
FT                   ESANFKPENIRMTAKKVGIRSEASSRNEKDLDPNLAEIAANRAAQLVEMLGAGKVLKGV
FT                   VDVYPNKPEPKKLVVNPQRINHLLGVDVPMEQFVGILESLEFKCNLVANDKLEIDVPSF
FT                   RTDMEQEADVWEEIARIYGFENIPSVQLEGNTTAGIKTSKQKFMDALKDNSTAVGLNEI
FT                   LTYSFVSPKGVDKIRVPEGNAKRNFVKLLNPLGEETSVMRTTLIPNMLDVLSTNVSHKI
FT                   EEVSAFECGHIFIPQDSELPKEENRMCVGMYGKDVDFFALKGTIETILVNVGFKGYEIE
FT                   PQDNNTTFHPGRCAKIVYNNKYVGTLGELHPDVIENYNLGQRVYVAEIDIDFVFDNSDR
FT                   TKNYVPLPKYPSTSRDIALIVKDDVFVKQIEDIIKENGQGLVESYKLFDVYKGSQIEAG
FT                   YKSIAYSITYRSKDKTLTDEDVAKVHDKILSELSEKLNANLRSN"
FT   CDS             776646..777254
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02558"
FT                   /db_xref="GOA:C9YJ79"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ79"
FT                   /protein_id="CBE02558.1"
FT                   /translation="MSGEVRMNKVMVKIHGAEYPMVGDKSEKFMISIADFVDKEMDKIT
FT                   RQNPKLSLSVAAILTALNISDLLFECSDENEKLIKANEELSKKVGASNEELQLEIKSLK
FT                   LTIAEKEAENREAETKMKELIEIIENKKQEIFELSNTTEGSRAELDVYKNKIEELSTQL
FT                   EEANERATIAENLASEFQNKAYDLQLKCTGLNNDAKNVE"
FT   CDS             777596..778279
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0628"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02560"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ80"
FT                   /protein_id="CBE02560.1"
FT                   /translation="MTSKSQMSESFFLCSLLAITGGFLDIYTYVVRGKVFANAQTGNIV
FT                   LFGLNIAEGNVKESFYYLIPILAFMLGVFIAEKIRKYFTNNKTKIHWRQVIIIIEMITI
FT                   LIVSFIPRGRFNMFVNVAISFICSMQVESFRKVNGNSFATTMCTGNLRSATETLFHYIH
FT                   TKNIFMIKKSLQYYAIIIFFISGAILGTFFTKIFVEKSILICFFILAVVFGIMFINKDD
FT                   SFNEN"
FT   CDS             778771..781389
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0629"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02561"
FT                   /db_xref="GOA:C9YJ81"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ81"
FT                   /protein_id="CBE02561.1"
FT                   /translation="MKKIELLAPVGSFDSLKAAVQNGANAVYLGGKDFSARASANNFDR
FT                   NELIEAVKYSHIRGVQVFVTVNTLIKQYEIEDFVEYVKFLYDIDIDALIVQDIGMARLI
FT                   KKLLPDFELHASTQMVAHSLEDVKYLQSVGFDRVVLARELNVDEIKWICENTTVDIEVF
FT                   VHGALCVCYSGQCLMSSMIGNRSGNRGRCAQPCRQKYELIDINTGEVVKSNGDYLLSPR
FT                   DLSTIEDLDKIIETGVLSLKIEGRMKKPEYVATVVSGYREAINEFVDKKKISISEEIIN
FT                   NLYTIFNRKFTKGYILGEVGKDIMNSNRPNNQGLYIGKVLDYNRKNKRLRVMLENTLKK
FT                   GDGINLGGGTIGRIIKDGEITTIAHKGDLIELDFVGEAKRNQLIYKTSDSELMNRVQAT
FT                   FQQDKEFIKTNIRAKVSIKLGKKPELFISDFCGNKSVVEGDKIVEKAIKVALSKEKIET
FT                   QIQKLGNTPYKLKEIEIDLDEGVSMPISVLNQMRRDCIELLDEERIKIKDRKFKKNRLK
FT                   YQPNRVNKQKKLDTVPKIRVKVKNLEQLEAVLNYNVDLIYYEDINTLSKALQMASSISI
FT                   DSSISIDSSISIDSSISMDLDTSSSLGIPKELMGSNTNNIDTLSNTSKIDTLNKNHYNT
FT                   AVTDKKLIYSAPRIVRNKEYKQFEILDNIKGINKVQIGNWGSMEYFKKKDLNIDCYLNA
FT                   FNSESINHFKEEGASTVCLSQELNLNEIKQTLKYTDVEIEAVIYGYAPMMVTEYCPMGV
FT                   VVRDCKKDKRVAKCKESSYALRDFTDASYRITQDIFCRSTIYNSKVTCMLDNLYELEEI
FT                   GIDVFRIDFTVEDSEMVKKVIEAHIEVLSNNYKLGKKATDLYKKLDEIGTVAGHYYKGV
FT                   E"
FT   CDS             781493..782071
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0630"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02563"
FT                   /db_xref="GOA:C9YJ82"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ82"
FT                   /protein_id="CBE02563.1"
FT                   /translation="MREEALEILFKYLETDRMRKHCYAVEAVMRELAKRLEPEKEEEWA
FT                   VAGLLHDLDSDIVGRKPGEICEGHATTTVELLKKENFGDEEMYRAILGHHDGMGVTRTS
FT                   LMEKAIYAADPITGFITAIALVYPDKKLTSVKTKSVIKRMKETRFASNVNRDAMRSIED
FT                   IGIPFDEFAELSLNAMKNISDVLESAENN"
FT   CDS             782105..782581
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0631"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02564"
FT                   /db_xref="GOA:C9YJ83"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ83"
FT                   /protein_id="CBE02564.1"
FT                   /translation="MKLTTICYIEKDDKTLMLYRNKKKDDIHEGKYVGVGGKFEQGETP
FT                   EECVIREVKEETGLTLKSLSYKGLITFPKFKDEEDWYMFLYFSDEFEGELSEKDLNDCK
FT                   EGNLIWVGNDKIFDLNMWEGDRLFLNWAKTGNIFSAKIVYDNGKLKDYNVSFLD"
FT   CDS             783100..783921
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0632"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02566"
FT                   /db_xref="GOA:C9YJ84"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ84"
FT                   /protein_id="CBE02566.1"
FT                   /translation="MIDINLEKCVGCGMCESDCLVNAIKVKDDKAKVKNILCINCGHCM
FT                   AICPTDAIEMQGFDKNEVIEYNRESFELEPEKLLNFIKFRRSIRQYKDIEVEEEKIKNI
FT                   VEAGRYTPTGGNRQPIRYILVKEKLKEVKELAIQGLYNLALDTDDNDPVRSIYKNTFKK
FT                   MYKRYKENGNDSLFYDAPLLMIVVGDMSLGGSAYVDGGLAASNMELMAYSQGLGICYNG
FT                   FFVMASNVEPKIKELLGMSENEAVITSFILGYPDVKYKRTVNRNTAKFEMR"
FT   CDS             784144..786657
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0633"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02568"
FT                   /db_xref="GOA:C9YJ85"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ85"
FT                   /protein_id="CBE02568.1"
FT                   /translation="MEDCVVNLKKLLLLIIVITSIFTSCIFSFGINAIGNDNRTIRVAY
FT                   PIQKGLTEIDEQGNYFGYTYEYLLEIAQYTGWNYEFVQVPGEINESITKLMKMLENGEI
FT                   DIMGGMLYNEPMQKIYNYAGNSYGVANTVLQALYENTDIDNIMSSQDVKKIRIAVIENS
FT                   DTRLKELDEYCKMNLMSPELVYCKTSDEQLEVLKSGKADVLLNVSMNPIEGVRTVAKFS
FT                   SKPFYFITPKGSTDLTQKLNSAINNIEQKDPYFSTTLYEKYFTPENNQMFLSDEETNYI
FT                   KDTEKLKVGVLLNKPPFQNADKDTGELRGISIDLLNHICDKTGLEFELVPVKSQEDLED
FT                   MAKKHEIDIVAGMIYDYEYSREHNIAMSRPFLSTQYTMMINNKLNENSLNGKRIALAKG
FT                   IDYYGQFEENIVWYDNLEECIEAVNKGYADYTYGEGYSMQYYMNQPKYKNVRLVPQTYE
FT                   AKSICFGIIKKDKQELLNIFNKAIISISSEKMQSIVYQNTTYRQDFSLLYIMQQNPIET
FT                   IFIVASLLICIIGFMAFGLHTRTSMNEKISLELKKHTQLYEMTSEYFFEYDYKQDKLII
FT                   SMPEKGIETYYGLDKSDKESENGNIENERDKIRREYNKKFFDVIKSQENGTTEMYSIML
FT                   DDTFHWIRITSKIIYNDRKIPMYVIGKIANIDSEKEEKNRLLDKVQRDSLTNIYNAAYI
FT                   RKLTTQNLLNLSTEKNGALLIIDIDYFKSINDTYGHLVGDKVLIDVAKVLDESFAKDDI
FT                   VGRLGGDEFSVYINDIINKEELINKCNDVYNHIHLIKLPNGESLSISMGVVITKRGQEY
FT                   DELYQIADNALYDSKRQGRNRFKIV"
FT   CDS             complement(786861..788312)
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="CDR20291_0634"
FT                   /product="putative aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02570"
FT                   /db_xref="GOA:C9YJ86"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ86"
FT                   /protein_id="CBE02570.1"
FT                   /translation="MGNVLEGLKPESVFKNFEKISQIPRGSGNEKGISDFLLSFGKNLG
FT                   LETIQDESLNIIIRKPATKGYENCPGVVLQGHMDMVCEKEKNVEHDFLKDPIKLRIDGD
FT                   MIYATGTTLGADNGIAVAMGMAILEDNTLEHPALEVLVTVNEEDGMNGADALDPSLIKG
FT                   QYILNMDSEEEGYLLVSCAGGKTCVVSLPVEYKEVKGDKQGLLVEVTGLLGGHSGMEIV
FT                   LQRANANKAIARVLSVLNVDYELASVDGGTKHNAIPREAKCVIAVNKADVESAKKQIND
FT                   ILTAFKHEFTTSDPGMTYSVAETSVDKVLTKDCKEKVVQMSCLTPHGVQSVSLDIEGLV
FT                   ESSTNFAIIETKESTIEFLTSVRSSVMSIRDEIADRIRLLAQALGANYDLIAQYPAWEF
FT                   KKGSKLEKICSETYEKLTGKVPTVMALHAGLECGLLLDKLPHAEAISIGPDMFDVHTPN
FT                   EHVSIPSVANVWDYVIEILKSMNQY"
FT   CDS             788629..791007
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0635"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02571"
FT                   /db_xref="GOA:C9YJ87"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ87"
FT                   /protein_id="CBE02571.1"
FT                   /translation="MNEKSLRVLEYNKIIDLLKKKASSSLGLKYIENLVPNTDFVEVKS
FT                   MLEETSEAQSIIIKRGSVGLEGIHDIEDKVKRAYIGASLDPGSLIMIADTLRVARRLRN
FT                   SLSSSDEEDFNYPIIQSLSNSLYVYKDIEDQIYNAIISEVEISDNASSTLRDIRRRIAQ
FT                   KNQSIRSKLNSIISSTTYQKYLQDAIISLRGDRFVVPVKSEYRSQVAGIVHDQSSSGAT
FT                   LFIEPMTIVEMNNELRQLKLGEQEEIERILSEISAMVGEVSEDLISNQEILGRLDFAFS
FT                   KGKLSIQMRGIEPTLNEDKYLNIKNGRHPLLDKKKVVANTIYLGRDFHTLVITGPNTGG
FT                   KTVTIKTVGLFALMTQSGLHIPADYGSSMCVYDNVFADIGDEQSIEQSLSTFSSHMTNI
FT                   VSILQNVTADSLVIFDELGAGTDPVEGAALAIAVLEDINSVGAKCIATTHYSELKNYAL
FT                   TKPGVENAAVEFDIETLSPTYKLLIGVPGKSNAFEISRKLGLSDYVISRAKEYINTENI
FT                   ALEDVLQNVEKNRIKAVEDREEAERLKEEIEKLKVEYDEKLEKLVSQRDKMIEKAKSEA
FT                   FSIIRQAKEEVDIIIKELRNLEQERASKEKNRKIEELRKELTSSMGSLQPTVKSMIVPK
FT                   VSNKEIKDLKPGEEVKVITLNQNGSVVSVDKKRKEAVVQIGIMKMTLPFKSLQKTRKDV
FT                   STNVTKSTRNIIRSKSGSVKNEVDLRGLNLEEAIMEVEKYLDDAYVAGLESVTVIHGIG
FT                   TGVLKAGLQDILRRNRHVKSQRGGQYGEGGAGVTIVKLK"
FT   CDS             complement(791047..791607)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0636"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02573"
FT                   /db_xref="GOA:C9YJ88"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ88"
FT                   /protein_id="CBE02573.1"
FT                   /translation="MLFYLFLYINISFIYFFYSFIYFYTSILALYTFFTLLSIFYKSFS
FT                   LLIFIPSSSNSLAVIPFPGIFLPEKLPSYIRLHPQEGLPSFSIASLHTYKFAIFRVSLA
FT                   PLTKFSVTSLLSLVITFPSTISAGGLGVDRPPNCSGHTSVNSLPFKYSLTFSFSLLSPL
FT                   YLQFIPIKHADTNIIKMCSYTNS"
FT   CDS             791899..793599
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="CDR20291_0637"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02575"
FT                   /db_xref="GOA:C9YJ89"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ89"
FT                   /protein_id="CBE02575.1"
FT                   /translation="MQDFKVAISNCLKEKIEDLSKEEIEALIEVPPNKDMGDYAFPCFK
FT                   LAKVFRKAPNMIASELAESIEPSGEITKVIQLGGYVNFFVNKSQLAETVIKKVLDEKEN
FT                   YGHSDFGKDKTVIVEYSSPNIAKPFHIGHIRTTVIGNALYKIYDSQGYKTIRINHLGDY
FT                   GTQFGKLIVAFKKWGEKEVVESNPIPELLKLYVRFHDEAEQHPEMEDEARAWFNKLENG
FT                   DEEAQELWQWFRNESLKEFNRVYKLLDIEFDSLAGESFYSDKMNRVIELLEEKNLLKES
FT                   KGARIVDLEEYKMPPALITKNDGSTLYMTRDLAAAIYRKETYDFDKCIYVVGSQQNLHF
FT                   QQWFKVIELMGYDWAKDLIHVGFGMVALEEGTMSTRKGRVVFLEDALNQAIDKTKEIIL
FT                   AKNPNAKNVDEISKQVGVGAVVFQELSNSRIKDYTFSWERTLSFDGETGPYVQYTHARC
FT                   CAVLRKAEVEVTSDIDYSLLADEDSAEVLRVIESFNKNILLALKKNEPHIVTRFMLDLA
FT                   QAFNKFYHDNPILVENLEIRKARLALVLATKQTLENSLKLLGMHAPERM"
FT   CDS             793853..794776
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02577"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ90"
FT                   /protein_id="CBE02577.1"
FT                   /translation="MNDELLKKVYTSSFSSASRALKDLTIINTKSLIDDKTQRCVYIDE
FT                   NRLRDELIYYRFYGEKIGNINFLNILLPLILSNTNIQKSEDEVIKLIKKYVIYFKKEEL
FT                   LFDYLLGSVVYNSIMHNLINNSKIEYVELLQSIKDKIIGFSIELDKSDVVKFQMARIKA
FT                   IQLIDKYIDLKSEDYDEESILLNVLNVLYDVYMEDRTVENEGINSIKKSILSILGEDSK
FT                   LNEDNIDFIFSMSEYVVKLRKYKIGVKAYNKSIDPRSLIRLEEGNTIIDPIFNQITVMS
FT                   KTFNDNILSIKINSKSGIYILKFKKV"
FT   CDS             795123..796877
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0639"
FT                   /product="putative adenosylcobamide-dependent radical SAM
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02579"
FT                   /db_xref="GOA:C9YJ91"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ91"
FT                   /protein_id="CBE02579.1"
FT                   /translation="MKILLTTLNSKFIHTNLAIRYLKEFVRDLIEVNMKEYTINNDLDY
FT                   ILKDIYKNEYDIILFSTYIWNVGDIVKLCDNLKKIRPNTKIALGGPEVSYDSYEAMKKY
FT                   DFVDYILYGEGELIFRDLVLHLQGKMKINDVNGLVYRQGNEIIVNKPMELLQDLDEIPS
FT                   PYENLNPKEYENRIVYYESSRGCPFNCQYCLSSTIPGLRYFSLDRIKSDLKALIDARVS
FT                   QIKFIDRTFNANRKVAMEIMDFLMKNDNGYTTYHFEVTAYLIDDKMLEFLADCKEGLFQ
FT                   FEIGVQSTNEKTLDAVGRRDDFKKLSHVVQTVASYRNIHQHLDLIAGLPYEDYKSFENS
FT                   FNDVFNLGIEHLQLGFLKMIKGTGMRKVADEHGFKYKDYAPYEFLYNNYISYEETLKLK
FT                   DIEDILERYYNSKNFVLSMRYIIGRFYKQSPFKFFEVFAKYFDENGYFDLAQGKNQLYK
FT                   ILMDFYNEKINIDNDVFNDILKYDYISLGKTSNIPQFFNKLDVDDFKNRCHVFLQDNDN
FT                   LSTYLPSFVDKPAKHIIKYVHFEPFRFNVVDLKNDINTEIREVENVVLFEYDDKKIFEK
FT                   SKTHKVEI"
FT   CDS             796895..798037
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02580"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ92"
FT                   /protein_id="CBE02580.1"
FT                   /translation="MDFKIEKYLLKKAEELAFITIKHGGEFKLKSYKVPKGGLDVPIKN
FT                   EVLVKGIKEKTAQDKLNSMSIADAMIYIIGIDSKFKNNAEYEKFLNALSKDIDLDLKSY
FT                   MGYMSRKYFEIGEHTDSLIYIKAFITMYPDDLDAMYNYAIVCQEIAKQYQKDMDDKAMN
FT                   AFLLEAMAKLEKVIDVDENFALGYYHLGYHYYNQGQYLKTKLTWEEALRLGLDADLVAE
FT                   VQENLGKMDFKVQYEEGYTLVFQGKFKEGLEKLLPLEEEHMDWWNLLFMIALGYKGMGE
FT                   IEQAKMYLEKILIIKPNQVDTIVELGLCEAYKNNLDKAIEYFEQAAKIKEDPEILCNLG
FT                   MAYLNNGDIDDATYYIERAYELNPQDEITIACLRELGINK"
FT   CDS             798123..798242
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0641"
FT                   /product="probable sugar O-acetyltransferase (fragment)"
FT   CDS             798358..799269
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0642"
FT                   /product="putative phosphate butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02583"
FT                   /db_xref="GOA:C9YJ93"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ93"
FT                   /protein_id="CBE02583.1"
FT                   /translation="MIKKLDDILEQLKGGEKIVLSVAAAHDKEVLMAIKDAVERNIITP
FT                   ILVGNEGKIREISKEIGFDLSGIKIVDKDDIKECAEIAVKLVSSKEADFVMKGLLDTSV
FT                   ILKEVLNKDYGLRTDSLLSHVMVYELEKYHKLLITTDGGMNIAPDYEQKAKILKNSIKA
FT                   AKALGMETVKVACLAAKEKVNPKMQATVDADMLAKACKEGEFGENVIVEGPLAFDLAVS
FT                   KEASEIKGFKSEVSGDVDIILVPTIEVGNGIGKAFTYMADSKSAGIIMGAKAPIVLVSR
FT                   ADSHESKLYSIAYGAIVAKNMK"
FT   CDS             799876..801795
FT                   /transl_table=11
FT                   /gene="cooS"
FT                   /locus_tag="CDR20291_0643"
FT                   /product="putative bifunctional carbon monoxide
FT                   dehydrogenase/acetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02585"
FT                   /db_xref="GOA:C9YJ94"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ94"
FT                   /protein_id="CBE02585.1"
FT                   /translation="MDEKMLTIDLNSQKMIAKAREEGVETMYDRKEGFKAQCGFGLQGV
FT                   CCRICGMGPCRISPKTPRGLCGADEHTIVGRNFARMVAGGTAAHSDHARDIAHTLALAD
FT                   PNGNYKIRDEAKLITLAKEWDVETEGRDIYDVAHEVAEIALMEFGKPFGTLRFIKNAPE
FT                   PRQKIWKEYAIEPRAIDREIATIMHSTHIGCTGDIDSLIHMSLRTSMADGWGGSMIGTR
FT                   LSDILFGTPVPRRTEANLAVLEENKVNIILHGHEPALSEMIVLASEEPDLVALAKEVGA
FT                   DGINLAGMCCTGNEITMRHGVKIAGDFHQQELAIITGAVEAVIVDVQCIFPALARVADC
FT                   YHTKFVTTSPKAKITGSTYIEFREEQALDDAKAIVKEAILNFKNRDKSKVLIPELKSGA
FT                   TVGYSVEAVVNQLDRVVNSHIDPAGTVKPLTDCLKAGVLRGAAGVVGCNNAKGVSNEAH
FT                   VTIMKELIKNDIIVVTTGCGASAAAKFGLMESDAAEKYAGKGLATVCKLVGIPPVLHMG
FT                   SCVDISRILDLVGAAANYLDMDMCDLPVVGIAPEWMSEKAVAIGCYVVASGIDTYLGIM
FT                   PPIAGSSRAVDILTSELKDKVGATFTVNTNPKELAATIIEDIEKKRVHFEALVEEKMAE
FT                   KAEA"
FT   CDS             802105..802884
FT                   /transl_table=11
FT                   /gene="cooC"
FT                   /locus_tag="CDR20291_0644"
FT                   /product="putative carbon monoxide dehydrogenase accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02586"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ95"
FT                   /protein_id="CBE02586.1"
FT                   /translation="MKIAITGKGGVGKTTFSSMLSRMFAEDGYRVVAVDADPDANLALA
FT                   LGFPKEVYESIVPISEMKKLVSDRTAASVGSFGKMFKMNPKVDDIPENFCKEYNGVRLL
FT                   TLGTVDSGGTGCVCPEHVLLKRLCSHLILQNKDVVVMDMEAGIEHLGRGTAQGVDAFIV
FT                   VVEPGERSLQTYRKVKKLGHDIGVNKVFVVGNKIRNKEDEEFIIQNLEDGESLGFIYYN
FT                   QDVIDSDRANQSPYDSSETTKEQIKAIKDKLMSLKDK"
FT   CDS             803133..804809
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="CDR20291_0645"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02588"
FT                   /db_xref="GOA:C9YJ96"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ96"
FT                   /protein_id="CBE02588.1"
FT                   /translation="MGFKSDIEIAQEAKPQDIREVAKKLGLGEDDVELYGKYKAKVDYN
FT                   LLKRETGKKAKLILTTAINPTPAGEGKTTTTIGVADAFAKLDKNVLVALREPSLGPVFG
FT                   VKGGAAGGGYAQVVPMEDINLHFTGDFHAIGAANNLLAAMLDNHIHQGNALRIDPKKIT
FT                   WRRCVDMNDRQLRNIVDGMGKKGDGAVRQDGFDITVASEIMAAFCLASDISDLKERLGN
FT                   IIVGYSYEGEPVTARQLKANGAMAALLKDALKPNLVQTLEGTPSFVHGGPFANIAHGCN
FT                   SVIATRMAMHFADYVITEAGFGADLGAEKFLDIKCRMANLKPDAVIIVATVRALKYNGG
FT                   VAKADLNNENLEALEKGLPNLLKHVENITQVYGLPAVVAINRFPLDTEAELKLVEDKCK
FT                   ELGVNVALSEVWAKGGEGGIAVAKEVLRLLDEEENNFRFCYEDDLSIKDKINAIATKIY
FT                   GADGVDYTPEADKEIANLEKLGFTKVPVCMAKTQYSLTDDQTKLGRPTGFRITVRQATI
FT                   SAGAGFIVALTGEIMKMPGLPKVPAAEKIDVDENGVIAGLF"
FT   CDS             804914..805546
FT                   /transl_table=11
FT                   /gene="fchA"
FT                   /locus_tag="CDR20291_0646"
FT                   /product="methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02590"
FT                   /db_xref="GOA:C9YJ97"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ97"
FT                   /protein_id="CBE02590.1"
FT                   /translation="MKIADKTCVDFVEVLSSKEAVPGGGGAAALVGAIGMALGSMVCNL
FT                   TIGKKKYAEYEESVKEILSKAGKLEKDLLKMIDDDAECFLPLSKAYGLPKETEEEKRIK
FT                   AETMEKALKVACEVPLNIVRVCYEAIKLHEDLVDKGSRLAISDVGVGVQCLRAAILGGQ
FT                   LNVVININSIQDKEYVNKVKIEVDKLVEDGVKICDEVYAKVEKALGK"
FT   CDS             805638..806510
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="CDR20291_0647"
FT                   /product="putative FolD bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02592"
FT                   /db_xref="GOA:C9YJ98"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ98"
FT                   /protein_id="CBE02592.1"
FT                   /translation="MEGMSTKGQIIKGKPVADKISEELIKEVDLLVKEGINPKLTIVRV
FT                   GARSDDLSYERGALKRCQNIGITTEVLELAEDITQEEYIDVLKRVNDDKNVNGILCFRP
FT                   LPKHLNEEVIKYVIAPEKDVDCFSPINSAKVMEGDKSGFPPCTPTAVVEILKHYNVDLK
FT                   GSKVTVLGRSMVVGKPVSMLLLSEHATVTICHSKTKNLSGVAAEADVLIAAIGRAKMVD
FT                   ESFVKDGAVVIDVGINVDEEGNLCGDVDTNAVLDKVSMITPVPAGVGSVTTSILAKHVV
FT                   KACKLQNNK"
FT   CDS             806547..807221
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02594"
FT                   /db_xref="InterPro:IPR022026"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJ99"
FT                   /protein_id="CBE02594.1"
FT                   /translation="MIISENKPLEEVLGYLKDFDKLVLVGCNQCAATCKSGGEEEVLKM
FT                   KETLEGEGKKILGYVMLDPACNLLKSKKDLKALKEETKEADAVLSLACGDGTQTIVKNL
FT                   KDKPVYPANNTLFIGEVQRVGEYEEACKACGDCELGWTGGICPVTMCAKGLMNGACGGA
FT                   KNGKCEVNSENDCAWIKIYERLEAIGQLDNLAEIRPPKDYSKQNNPRSLSAKKKKEAAA
FT                   NS"
FT   CDS             807257..808138
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0649"
FT                   /product="putative methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02595"
FT                   /db_xref="GOA:C9YJA0"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA0"
FT                   /protein_id="CBE02595.1"
FT                   /translation="MSLLRETLESGKFAVTTEMAPPKGTDLSHLIECAKPLVGRVHAAN
FT                   VTDFQSAVMRATSLATCKLLKDAGLEPVIQITGRDRNRIAIQGEMLSAGVFGINNLLAL
FT                   TGDHTSVGDHPQAKGVFDLDSVGILQTAETLMAGTDMAGNKLKGSPDFYLGASVTPEYS
FT                   PIEVQLLKMQKKIKAGAKFFQTQALYDINTMRKFRELTRDMDCKVLAGIVPLKSPGMAK
FT                   FMTANVPGIFVPDEQIERLRAAGKENWVSEGIKMAGELIKQLKEEDLCDGVHIMAIGAE
FT                   ENIPAILDAAGL"
FT   CDS             808182..809567
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0650"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, dihydrolipoyl dehydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02597"
FT                   /db_xref="GOA:C9YJA1"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA1"
FT                   /protein_id="CBE02597.1"
FT                   /translation="MKIVVVGGGPGGYVAAIKASMLGADVTVIEKRRVGGTCLNAGCIP
FT                   TKALLASSGVLNTVKEAKDFGIEIDGTVKPNFTAIMERKNKVVNQLISGIEFLFEKRGV
FT                   NLVNGFGKLIDKNTIEVTKDDGTVETIKADKIILANGSVPVVPRMFPYDGKVVITSDEV
FT                   LGLEEIPESMLIVGGGVIGCEIGQFFRALGTEVTIVEMVDQILLNEDKDVAKQLLRQFK
FT                   KDKIKVITGIGVQTCEVVDGKAVATLSNGKVIEAQYALVCVGRRPNLDNSGVEDIGIEM
FT                   ERGKVVVNEHLETNVEGIYAIGDIIDTPFLAHVASKEGIVAVENALGKTKVVDYRAIPR
FT                   CVYTEPEVAGVGKTEKQLEAEGVEYNVGQFDFRGLGKAQAIGHFQGFVKVIADKETDKI
FT                   IGAAVVGPHATDLLTELSLAVHLGLTVEQVGDAIHPHPSLSEGLMEALHDVHGECVHSV
FT                   PKL"
FT   CDS             809623..810393
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0651"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, nickel-inserting subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02599"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA2"
FT                   /protein_id="CBE02599.1"
FT                   /translation="MGYNIAVAGKGGTGKTSLTGLLIDYLVKDKKGPVLVVDADANANI
FT                   NEVLGIEVEATIGEIREEVNQREKLGNAFPGGMTKAQYLQFRLNSIIEEGEGYDLLVMG
FT                   RSEGEGCYCFVNGILREQVNKISGHYKYLVMDNEAGMEHLSRKVTRHVDTLLLVSDCSR
FT                   RSIQAVARIRDLAEELKLSVGRILLIVNKVPNGVMNDGVKEEIEKHNLELIGVVPMDEL
FT                   IYEYDSTGIPLVNLPEDSKSKVAMKEIFAKLELK"
FT   CDS             810413..811357
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0652"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02600"
FT                   /db_xref="GOA:C9YJA3"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA3"
FT                   /protein_id="CBE02600.1"
FT                   /translation="MAFKMSTQKYSGKISEVEVGIGEKAIKLGGENVLPFYSFDGEVGN
FT                   SPKIGIQISDVYPESWTDSYKELYKDVANCPVEWAKYVEANTQADFICLKFDGSDPNGL
FT                   DKSVDECADVAKAVIEAIKLPLVVAGSGNHEKDGKLFEKLAQTLDGHNCLFMSAVEDNY
FT                   KGVGASAGMAYAHKVGAESSVDINLAKQLNVLLTQLGVKGENIVMNVGCSAVGYGYEYV
FT                   ASTMDRIRLAAFGQNDKTLQMPIITPVAFEVGHVKEAIAPIEDEPDWGCPEERTIAMEV
FT                   STAASVLVGGSNAVILRHPKSIETIKELVNALA"
FT   CDS             811388..812755
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0653"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02602"
FT                   /db_xref="GOA:C9YJA4"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="InterPro:IPR016218"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA4"
FT                   /protein_id="CBE02602.1"
FT                   /translation="MALKALDIFKLTPKKNCKDCGFPTCMAFSMKVASGAVEVGKCPHM
FT                   SDDAIAKLSEATAPLMKALKVGAGASEYELGGETVLFRHEKTLVSRNRYAVSFCTCMSD
FT                   EAVDAKIANMKKVDYVRIGEQMKVEMAVLEYCGDKDAYLKLIDKIKGSGLEVAYILACD
FT                   DAQVVKEAVEVLKDARPMVYGATKENYKDMIEVVKGASLPLGVKAGSLEELYETVELIQ
FT                   AAGYKELVLDVTGENIKDTYTNAIQVRRTALKEQDRTFGYPSIVFANRLSNSNPMMEVA
FT                   LSSIFTIKYGSIIVIDDISYAKALPLFALRQNIYTDPQRPMRVEPKIYPINNPDENSPV
FT                   LVTVDFALTYFIVAGDIERSKVPVWLVIPDAGGYSVLTSWAAGKFGGNSISAFIKESKV
FT                   EEVTNCKDLIIPGKVAVLKGDIEDNLPGWNVVIGPEESMELPKFLKGYQEKACQTN"
FT   CDS             812805..813611
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0654"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02604"
FT                   /db_xref="GOA:C9YJA5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA5"
FT                   /protein_id="CBE02604.1"
FT                   /translation="MEKFMIIGERIHCISPSIRKALAERDPAPILKRAKEQLEAGAHYI
FT                   DFNIGPAERDGEEIMTWGIKLLQSEFNNVPIALDTANKKAIEAGLKVYDRTNAKPIINS
FT                   ADAGSRFDLIDIAAEYEAMVIGLCAKEGIPRDNDERMAYCQEILEKGLMLGMEPTDILF
FT                   DPLCLVIKGMQEKQVEVLEAIKMMTEMGLLTTGGLSNVSNGCPKHVRPVLDSAFLAMAM
FT                   ANGFSSAIMNPCDPELMKTVKSCDIINGASLYADSFLELNEGGFAF"
FT   CDS             813668..815794
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0655"
FT                   /product="putative carbon monoxide dehydrogenase/acetyl-CoA
FT                   synthase complex, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02606"
FT                   /db_xref="GOA:C9YJA6"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA6"
FT                   /protein_id="CBE02606.1"
FT                   /translation="MNLYNIIFTGSEQALGAAQAMLAEAIEKNGKEHKVAFPDTAYSLP
FT                   CIYAATGQKMNTLGDLEGALEVVKSLINRTHLLEHAFNAGLATALAAEVIEALKYSTMD
FT                   APYSEPCAGHITDPIIRSLGVPLVTGDIPGVAVVLGECPDAESAAKVIKDYQSKGLLTF
FT                   LVGKVIDQAIEAGVKMGLELRVIPLGYDVTSVIHVVSVAVRAALIFGGLTPGDLNGLLE
FT                   YTANRVPAFVNAFGPLSELVVSAGAGAIALGFPVITDQTVLEVPMNLLTQKDYDKIVAT
FT                   SLEARGIKIKVTEIPIPVSFAAAFEGERIRKSDMFAEFGGNRTEAWELVVKKEATEVED
FT                   HKIEIIGPNIDEVDADGVLRLPLAVIVKIAGKNMQEDFEPVLERRFHYFLNYIEGVMHV
FT                   GQRDMAWVRISKDAFDKGFRLEHIGEVLYAKMLDEFESVVDKCEITIITDAEKVSELKG
FT                   EAIAKYNARDERLASLVDESVDTFYSCNLCQSFAPAHVCVVTPERLGLCGAVSWLDAKA
FT                   TKELDPTGPCQPIEKGECLDDRTGVWNSVNETVNQISQGAVESVTLYSILEDPMTSCGC
FT                   FECICGIMPEANGFVVVNREFASVTPVGMTFGELASMTGGGVQTPGFMGHGRHFISSKK
FT                   FAYAEGGPERIVWMPKELKDYVADKLNATVKEMTGIENFCDMVCDETIADDSEGVLAFL
FT                   EEKGHPALAMESVM"
FT   CDS             815881..816258
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="CDR20291_0656"
FT                   /product="putative glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02608"
FT                   /db_xref="GOA:C9YJA7"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA7"
FT                   /protein_id="CBE02608.1"
FT                   /translation="MKLLPELKYSKDHEWVKVIDGDVVYIGITDYAQDQLGEILFVETP
FT                   EVEDTVTKGVDFGVVESSKVASDLISPVNGEVLEVNEKLEDEPECINEDPYENWILKVK
FT                   LADVAELDTLLSDKEYEAGLE"
FT   CDS             816304..818298
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0657"
FT                   /product="putative iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02609"
FT                   /db_xref="GOA:C9YJA8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA8"
FT                   /protein_id="CBE02609.1"
FT                   /translation="MSARKFSYTFLLSYIEQIGRDNMIKVSFTPNNKEVYCNEGDILLE
FT                   VARNADIFIDAPCNGNVSCGKCKVKLLNGKVDTEKTRHITDDEWEQGYILACCTKVISD
FT                   IEIEVPSKVSSSMHGMKIEGSNKKEDREIFERAKKIIEEHNLQFKTNIKKKYIEMEEPN
FT                   LDDNISDVDRLERYVRNSLGYNEIDFRLDILRKMPTVFRKSDFKVTITYVQKQKKLTII
FT                   NIEQGNKENSLYGVAIDIGTTSVVVCLVDLYSKEVVDKASSGNAQIKYGADVINRIIYS
FT                   TKKNGLETLHKAIVEETINPLLKTIYERNGIDKEDVVTLVAAGNTTMTSLFLGVYTDFL
FT                   RQEPYIPPFLKSPKLMGENVGLFVNDSAYVYLAPSVASYVGGDITAGVLSAGIWSSEEN
FT                   VLFIDLGTNGEIVFGNKDYMMSCACSAGPAFEGGGISCGMRASAGAIEKVIIDKETLEP
FT                   TLKIIDECAPVGICGSGIIDLICQMITKGVIDRRGKIYRDLDNKRVRFNEHEIGEYVLA
FT                   FKEEFDLENDIVVNEVDIDNFIRAKGAIYSGAYTLVDSLGMDFSILDRVYIAGGIGNNL
FT                   DIENSIIIGLLPDIDREKFTYIGNSSLVGSYLALISKDAKNKLEEIGNQITYVELSVYP
FT                   SYMDEFISACFLPHTNIEQFPTAKKLLEE"
FT   CDS             818323..819195
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0658"
FT                   /product="putative radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02611"
FT                   /db_xref="GOA:C9YJA9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJA9"
FT                   /protein_id="CBE02611.1"
FT                   /translation="MNKNLSEKMKIAFDIKLKNFGNKIEFAYPNQTLALSTTSNQCSLK
FT                   CAHCNGHYLNNMVPIEEYEEKVQSRNITSFLLSGGCSYEGDVPINTHINTIKNLKEKGY
FT                   RLNAHLGLMDKDSIVELCKYLDIVSFDLVFDDETIREVYKMKKSKEDYIEVYNTIQEHT
FT                   EVAPHICIGLKGGQIKGEYEIIEYLQKNPPNKLTFIVLIPTKGTEYENVEPPELEGVAD
FT                   ILCEARINLPDTEINLGCMRPRGVYRKELDQLSIMCGVNRIVLPSRSAKNKAIEMNMTI
FT                   NECKECCVL"
FT   CDS             819180..820130
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0659"
FT                   /product="putative radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02613"
FT                   /db_xref="GOA:C9YJB0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB0"
FT                   /protein_id="CBE02613.1"
FT                   /translation="MLRFMIRLSVGTAIELGILNKKSDIPPTTAYIMIGEKCINKCSFC
FT                   SQSIESSTRKDKLSRVIWPEFSKEEILDALKAYKGKNIKRICIQSMASEEAHNSVLDFI
FT                   NYISGKIDMPISLSAKLENDEQIKKFFSVGVDKIGIAIDASNKELYEKIKGNNYDEKLK
FT                   FITEMSKSYPNKISTHIIVGMGESHEDIYNLYIYLKENDVTISLFAFTPVRGTKMEKIN
FT                   QPSIESYRRVQLMSYMINKGYPKEYFKFKNGYLNSIKLDNDILKDINKGYPFEIRGCKD
FT                   CNRPYYNERPGSTIYNYSRPLNQSEIDLAIREINL"
FT   CDS             820177..820992
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0660"
FT                   /product="putative biotin/lipoate-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02615"
FT                   /db_xref="GOA:C9YJB1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR024898"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB1"
FT                   /protein_id="CBE02615.1"
FT                   /translation="MNQWRVIHNKSYEGAMNMAIDEAIFTAYKKGHNKPTLRFYTWEPA
FT                   CLSIGYFQKLEDEIDLDKCRCMNIDYTRRITGGRAVLHDNELTYSIIIGEDNPLIDKSI
FT                   NLSYRYISEGLVKGLNLSGIETDNLNRGERISRENLSAACFNAHASYEVTINNKKVIGS
FT                   AQSRKDGVLLQHGSIILDFDVEKLFKLIKTKTPELKERAMKFTAKKASGIENEIGRKID
FT                   IDILQKNIVKGLAEQFNVEFVEGDLTDYEKQLVKELYEKYKNEEYNKKR"
FT   CDS             821143..821334
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02617"
FT                   /db_xref="InterPro:IPR019300"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB2"
FT                   /protein_id="CBE02617.1"
FT                   /translation="MCESSAFICKSNNELEKVMENVVNIDPCDGKIYLTDLLGEQKIID
FT                   GIIKEIRLMDHKIIIQEN"
FT   CDS             821353..821769
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02619"
FT                   /db_xref="InterPro:IPR024208"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB3"
FT                   /protein_id="CBE02619.1"
FT                   /translation="MIIAVIDGMGGGIGAQIVSSLREELPTYVEIYALGTNSIATSSMM
FT                   KAHANKGATGENAIVVSAKKANIIVAPISVIIPNSMMGEVTCNISEAIADSEALKILLP
FT                   IMPENVELVGLEGKPLALLVKDSVNLIKKEFNIK"
FT   CDS             821785..822135
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02621"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB4"
FT                   /protein_id="CBE02621.1"
FT                   /translation="MIFDKEIVRYHHGHHDHDHCHEHTHGDICHEHPHDHAHDHDHEHS
FT                   HEESSESKDEKTLKILLVHWINHNETHEEGFREWVEKARAIGKEETAKSIEKAIEYMEE
FT                   ANKMLLEAKKHM"
FT   CDS             822675..823454
FT                   /transl_table=11
FT                   /gene="hisK"
FT                   /locus_tag="CDR20291_0664"
FT                   /product="putative histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02623"
FT                   /db_xref="GOA:C9YJB5"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB5"
FT                   /protein_id="CBE02623.1"
FT                   /translation="MKDGHIHSPYCPHGSKDDFEKYVQRAMDVGITEMTFTEHFPYANG
FT                   FRDPAPENDSCMSIEDLPKYFNDVKKLKEKYEGKIKINVGSEVDFIEGYEEGIKENLNK
FT                   YGKELEDSLLSVHIIKIDDDYYCVDYSVEEFQNLIDKLGSIEAVYNKYYETLIKAVNSD
FT                   LGIHKPKRIGHLNLVRKFNQVFPYDYKGNTILEDLIKLIKEKGYELDYNVSGNRKEYCK
FT                   EPYIDGYLLELVKKYDIPLVLGSDSHCAEEINKYDII"
FT   CDS             complement(823767..824648)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0665"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02624"
FT                   /db_xref="InterPro:IPR025389"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB6"
FT                   /protein_id="CBE02624.1"
FT                   /translation="MKKRLIIMILSVVLVLSSILTIFAYSNIKYNNNKLIYSNMIDKKT
FT                   QNSVKEILKENKINEKDIDTFIKAVNNYNKLQVKILQNNINISKSGYSSINAKQVPYNL
FT                   EKLQDNWVKKFPDYMDVNCRITAFRLFKDFINSNKKFTGDSIDLNVDLDTIMNNKDAKF
FT                   STKDVEKFINFFSAIPAKDTDDTIKIAEQIKNEWKKRKISFKNNKNISIINGFLRYPET
FT                   KNVFIGHTGICIKTKNGILFLEKYGVTSPYQVTKFKNKKGVKNYMFNRLKMSEGEIELP
FT                   DPIIMENDKLMK"
FT   CDS             825201..825713
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0666"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02626"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB7"
FT                   /protein_id="CBE02626.1"
FT                   /translation="MKVKKFKSGIVMALTVMAIGASLTNVSAMELNKSKEFETKYNEMK
FT                   RDFQEDYGKEDKFNITLDDEFTKEEVNGAKGIIKTTNKMNNEVVVLNYFDEMKSGIEFE
FT                   LKAKAEKNAILRDEFQQGYGKEDKFKVVLDDEFTKEEVNGAKGIIKTTDKETGEVIVYN
FT                   YFDELEK"
FT   CDS             complement(825689..826234)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0667"
FT                   /product="hypothetical protein (fragment)"
FT   CDS             complement(826392..827489)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0668"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02629"
FT                   /db_xref="GOA:C9YJB8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB8"
FT                   /protein_id="CBE02629.1"
FT                   /translation="MKKTYLFSPGPVMVTDKVRNSLLHYDICHRGNEFMDLFKDTQQKI
FT                   NKLYNATSNYYSLIVSGSGTSVNECVLSSIFDKEDAVLLVSNGVFGERLEEILFTYNVK
FT                   TYKPNFEWAEYPDLDILEKYIIENSDIKVIAMVFHETSSGMINPVPELGKLAKKYNKIF
FT                   FVDAISASAGEYIDVEEFNIDIITGVGGKALGAFPGSAYLCAKESILQNIKENQCKNVY
FT                   LNLYKHYKVAKSSSQTPNTPNVTLIFALNEALTEFLEDDSKIERYKECSAILRNGMEEL
FT                   GLTFLLPDKYMSNTVTSVFLPKEINVNEFILGLERESGYVVYPGKGKFLDANIFQVANM
FT                   GEIYPEDCYKFLDILKSKLEIKKVI"
FT   CDS             827782..829308
FT                   /transl_table=11
FT                   /gene="glpK1"
FT                   /locus_tag="CDR20291_0669"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02630"
FT                   /db_xref="GOA:C9YJB9"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJB9"
FT                   /protein_id="CBE02630.1"
FT                   /translation="MKYVLAIDQGTTGTRAVLINEKSEFVFSDYMEHTQIYPQSGYVEH
FT                   DPIEIWNNTKTVSNNVLQQAFESGINESDIKGIGIDNQGETVMLWDKNTGKPLYNAIVW
FT                   QCRRTYDYVENLKNIPGLENKIIDKTGLIIDPYFSGTKIKWVIDNVKGVKEKIKNGEVL
FT                   AGTLDSWLIWKMTGGKSFLTDVSTAARTMLFNIRDMDWDRELLDIIGVPRSILADIMPT
FT                   SGDFGTTDKEAFCGVSIKITASMVDQPAALFGNGCFEPGMVKNTYGTGCFLYMNIGEEL
FT                   NIAGNGILTTVAWKIGDKVTYAYDGGVYIAGAAIQWLRDGIGVIKNYSETDDMANSISS
FT                   TGGVYFVPAFAGIAAPYWDQYARGTMVGITGSTKKEHIVRATLESVALQVKDVVDSMNL
FT                   ASGKEIKMLRVDGGITKNNFTMQFQSDILDIPIEIAENPETTVLGVGYMAGLSCGVWNS
FT                   IDEIRSEFTISKKYIPNMTKQKREEILLGWNQAVKRAMNWENDTKKVCAN"
FT   CDS             829349..830464
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0670"
FT                   /product="putative ethanolamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02632"
FT                   /db_xref="GOA:C9YJC0"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC0"
FT                   /protein_id="CBE02632.1"
FT                   /translation="MPFDKIILYIMAVGVLLGALDRIIGNKFGLGEQFEEGFNSMGPLA
FT                   LGMVGIVCLAPVISDVLGPIIIPIFNLCGADPSMFATILANDMGGYPLAMELAHNKEAG
FT                   MLAGLVVSSMLGCTLVFSIPVGLGLIEYEDRPFFAKGLLIGLITIPFGGIIGGLIAGFN
FT                   LSMVIINMIPVIILAVILAVGLKFNSTLMINGSLVFGKFISILITIGLGAAAFQEITGI
FT                   VLIKGMTPIREGIQVIGSIAIVLLGTFPILHLLVKVLNKPLTIVGGKLGMDATSAAGLV
FT                   FTLANSIPVYKMMKDMSPKGKVVNTAWLVCATAALGDHLGFTAGVVPEMITPVVIGKLV
FT                   GGVLAIALAILMTKDLTLEEEQSIKMKKDAV"
FT   CDS             complement(830745..831509)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0671"
FT                   /product="DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02634"
FT                   /db_xref="GOA:C9YJC1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC1"
FT                   /protein_id="CBE02634.1"
FT                   /translation="MLPQERYEKILSILKSDNIIKINDIVQMFDISIETARRDLAHMES
FT                   IGLLKRVYGGAIPVIASSVELNYVKRKKINSNDKKQIAIKCSEFINTNDTIFMDTGTTV
FT                   LEVSKNLKDKKNLTVITNSILVANELMNTNIKVYVLGGYLRETEGSFSGPLTLSAIEQF
FT                   NVDKAILGAGGITLENGISDYHLEEALVRKKMIERSRKSIVVVEPPKFGINSFASVAPI
FT                   EHIDTIITSASIDHNIIIEFSQKGIPLVIADN"
FT   CDS             831946..832734
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0672"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02636"
FT                   /db_xref="GOA:C9YJC2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC2"
FT                   /protein_id="CBE02636.1"
FT                   /translation="MTTLIFFIVGIASLVVAFVIDGGHIGVLFVFSSALVVFGGTIGAV
FT                   GASTPFPVFKKSIKIMLLAFKNKKPNNIENIIYFKEIATKARKEGLLSVDKEISENDEL
FT                   DPFIRKGLELMVDGVDAVTIRNILESQIQITSKRHKEGIAIFDSAGGYAPTLGIIGTVM
FT                   GLVHILGNLSSNPDALGPQISVAFLATLYGVGSANLIWLPIASKLKAINQQEISERLLV
FT                   IEAILSILEGDNSNLMTEKLKIFLNSKELIELEEIGGRAE"
FT   CDS             832749..833495
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0673"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02637"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC3"
FT                   /protein_id="CBE02637.1"
FT                   /translation="MFMLYDEDEKEENNERWLLTYSDLITLLMIFFVIMYSMSNVDAEK
FT                   YKQLSQSLNSAFGGSSGVIEGGNSKIEPVVEPGSNDLDSLQNAKFKKVGEEIQKYLNEN
FT                   GMANSVSLRVQDRGLVISLKDTILFDTGKAVVKDNSRDKIIQIGKMLNEMNSYMRVEGH
FT                   TDNMSIKNSEFKSNWDLSVMRATNVVQLLIDNAGIAPDKLSAVGYGEFRPIAENSSEEG
FT                   RSKNRRVDIVLVDSKYDNVENVSKDK"
FT   CDS             833673..834047
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0674"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02639"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC4"
FT                   /protein_id="CBE02639.1"
FT                   /translation="MGNKNKNTKYKDKTRERYNKKVENLNKEKLNKDNKQSKKVDKIDD
FT                   IINKSSIVLCVLLVVFSLLYLFKLVQLNIIMILLVITVAIQQGLVSFGAFRNKNYVKAL
FT                   FSIFVIVCFLIAFKYVVNPV"
FT   CDS             834139..835599
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0675"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02641"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC5"
FT                   /protein_id="CBE02641.1"
FT                   /translation="MNRCKFAKLIITSMIVLLLTGCSLKKEDNYKLDPENPTSIQIWHY
FT                   YNGQQKMAFDKLVKEFNDTIGAEKGIIVEAFSQGNVVDLSEKVLDSANKKVGSEDVPNI
FT                   FAAYSDTAYEMDKLGLLVDMDKYISKEELNEYIDEYVEEGRINSKDEFKLFPIAKSTEI
FT                   LMLNKTDWDKFAKATNSNINDIKTIEGLVETSKKYYEWTDSLTKEPNDGKAFFGRDALA
FT                   NYIIIGSKQLGVEIFSVKDGKVTLNIEEKVMKKLWDNFYVPYINGYFASYGKFRSDDAK
FT                   TGDILALVGSSSGAAYFPDRVMLNDNESYNIETSVFQAPRFKGEGKYAVQQGAGMAVTK
FT                   STKEEEYASVEFLKWFTDKEPNIKFSIASGYLPVKKKTNDLNVIKEVMKKDNLSLSDKV
FT                   EGSIASSIEQINSCNLYTNKAFDGGTKARQILEYSMLDKAKEDSNKINELVKSGTSKKD
FT                   AVAQFNNDKNFETWFESFKAELENAIKK"
FT   CDS             835652..838528
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0676"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02642"
FT                   /db_xref="GOA:C9YJC6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC6"
FT                   /protein_id="CBE02642.1"
FT                   /translation="MENNLRKNNSIMKKMIFPLIIVMLIQTSLFCATILWGGTIKKLND
FT                   NSFDILNERVINRKNYIQNEMLQRWSNTSETEATINSSVKKILNEKNALIEDVGNNEEI
FT                   NKDIIKSISNDLIYLLRKNSVTGAFIILNDKNINDKPIDSKGEISRTGLYIRDLDPKFN
FT                   PNDNSDLLIERGSSDIARSFGISMDSYWEPKFSFKSENEQEGDDFFYKPFRAAIDNPNV
FT                   SSSNLGYWGSKFLLTNAGDRLMTYTVPLIYEDGTVYGVLGIDLSVNYLRELLPYSEING
FT                   NKKGNYILGVDRNNDMAFENVISNGYSLKEKFWDGLHSNLEQKESYKNIYKIKNKDNEC
FT                   GNGNIYASVQYLDLYNSNTPFENERWALLGIIEEKSLLSFSKRIEKLVIISIAISLLIG
FT                   LIGIYIASRLFTKPIVLLANKVRNSNPSKPVNLDKINISEIDELSSAIELLSANVADSS
FT                   SKLSQIIEMVDMPIGAFELYKNAENVFCTKDKKLKWIRMNIFEDELKVLGVVVDVTKEF
FT                   IEKRKIEYERDFDILTNLLNRRAFHSQIQEKFKNKDELKIAAFIMWDLDNLKYINDTYG
FT                   HDAGDEYIRCAADILKKFISWNGIVSRLSGDEFYVFIYGYESKDSIRDIINSVKKQMNN
FT                   TLLKLHDGTEFKIRASAGISWYPDDSTNYDELMRYADFAMYQIKNTIKGEVSEFDINIY
FT                   NKDSFLLSNREELNKLIDGQLVEYAFQPIVDCKGKVFAYEALMRPKIKTFSSPIDVIRL
FT                   ARSQSKLYQIERITWFKALKSFKKYKEKFGDCKLFLNSIPNNNLSKVDFEEIEDLYGEY
FT                   LNRVVLEITENDKINEDFIEKKKAYIDHWNIEIALDDFGTGYNGDAVLLYIMPDYVKID
FT                   MSIVRGIDKDENRQKILKNLISYSNERNIKVISEGVETKGEMETLINLGVDYMQGYYIS
FT                   KPSFIPEDISDKIKKELKICHENRNDVV"
FT   CDS             838605..840671
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0677"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02644"
FT                   /db_xref="GOA:C9YJC7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC7"
FT                   /protein_id="CBE02644.1"
FT                   /translation="MVELIITTNIDIRKLNENQLEAVEHIDGPCMILAGPGSGKTRVIT
FT                   YRIANMVVNKNIAPTRILAISFTKASSIEMKNRALNLSDDIRLNKVTYGTFHSVFFKIL
FT                   RYFERYNLDSIFDEKSKRMTIKAILKSLNIENADDDENIGQVINEISYVKNELMDKNEF
FT                   NSEVLTKDEFLKVYNLYEEQKSKVNKIDFDDMLIRTYYLLLNNKSALEMVRNVYKYILI
FT                   DEFQDINKVQFEVLKLICSPLNNIFAVGDEDQSIYGFRGARPDFLLEFEQYFNNTKKII
FT                   LDINYRSKSEIVYTANRLIDKNKNRYEKVIKCSQGDGGSVTYISPHDSEEEALYIAKEI
FT                   IDEIQKDYVEYSDFAVIYRTNIQSRALVDVFMDMRIPFVVKDSVITIYDHWASQDILAY
FT                   LRIGINPKSNKDWLRIINKPFRYISKDSINMVKDEKDFITALINKCNLHPKQVKTINDL
FT                   EIDLSYLNTLNPKNAISYIRTSLDYDRYVLDYCSNRKIKTNGLVEILNELESSATNFNT
FT                   VTEFLEHIDRVKTELTENNKNKQTEGVIFTTMHSAKGLEFRNVYIIGVNEGTIPHEKSY
FT                   DICKEEKKEEQLEEERRLMYVAITRAEEKLCISSTLNKYGKKVDKSLFINDIKSPTKKE
FT                   IDSIGVGDKVYHKKFHEGEIIKKDGIMFTIKFKDRERILDLKTCLLKNIIYTI"
FT   CDS             841699..842514
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0678"
FT                   /product="amino acid ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02645"
FT                   /db_xref="GOA:C9YJC8"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC8"
FT                   /protein_id="CBE02645.1"
FT                   /translation="MKVFKKLLSLGLVLGLTLSLVGCSGGGEKTKLEQIKDNGKLVVGT
FT                   SAEFPPFEFHKVVDGKDSIKGFDIMLAEEFAKELGVKVEIKDMSFDGLIGALNADQVDI
FT                   VLAGMSPTPEREKSVDFSELYYLSRNAVIVKDADIDKVKTEDDLKKLRVGVQAGSIQEE
FT                   YVVNTLKMTTTKSLKAIPDLITELKNGNIDAVVTNEAVSLINVKKYDGIKMANTEVGKD
FT                   VTEGMAAAIKKSDNNKDFIELLNKKIKELQDGKKIEEFLNEASTEAASN"
FT   CDS             842542..843219
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0679"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02647"
FT                   /db_xref="GOA:C9YJC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJC9"
FT                   /protein_id="CBE02647.1"
FT                   /translation="MSLDFSFLSRFGTSFLEGTGVTVSISLVALCFGFIIGIIICMAKI
FT                   SKSKVLRAISSIYIEVLRGTPLLVQIYIVWFGLPQLGIRFPMLFGIPSEFIASAFALSV
FT                   NSGAYVAEILRSGIQSVDNGQMEASRSLGLNYWSTMRYIIIPQAIKNILPSLANEFITL
FT                   VKESSIISVIGVVEIMRTADIVKNAAFRALEPLIVAAAIYFVITFTLSRLVGLLEKKLS
FT                   VSN"
FT   CDS             843278..844000
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0680"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02649"
FT                   /db_xref="GOA:C9YJD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD0"
FT                   /protein_id="CBE02649.1"
FT                   /translation="MITIKNLSKSFGDLNVLKNIDLEIAKGEIMVIVGPSGSGKSTLLR
FT                   CMNLLEIPTGGEIIFEGKNLVDKKTNIDEVRQNIGMVFQNFNLFPHKTILDNITLAPIK
FT                   LKKMTKEEAEKKAEILLSRVGLLDKKDSYPSQLSGGQKQRIAIARALAMEPDMMLFDEP
FT                   TSALDPEMVNEVLDVIKELAKEGMTMAIVTHEMGFAKEVADRVIFIDGGSILEDNTPEE
FT                   VFGNPKHERTKAFLAKVL"
FT   CDS             844648..845799
FT                   /transl_table=11
FT                   /gene="iscS1"
FT                   /locus_tag="CDR20291_0681"
FT                   /product="putative cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02650"
FT                   /db_xref="GOA:C9YJD1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD1"
FT                   /protein_id="CBE02650.1"
FT                   /translation="MEIYLDNSATTKPYQEVIDKMVYALNTEYGNPSSVHRKGVEVEKA
FT                   IKEVRQDIAKSLGAKEKEIYFTSGGTECNNTIIRGITSLNKKRKNHIISTNIEHPSVLN
FT                   TLKDLEEDGFEVTYLEVGKDGKINIEDLKNAIKSTTCLVSMMHVNNEIGTIQPIGEVGK
FT                   YLKGLKEKIYFHVDAIQSYGKINFRPSKYNIDFMSVSAHKFHGPKGIGFMYIKENNRLK
FT                   PMLTGGGQEIGIRSGTENVPGIYGLGEAVRILNKDLDVVISKVNNLKNILKNEIIDNIE
FT                   DIKINSPEDGVCHILNVSFRGTKGEVLLHYLEQKGIYVSTGSACSSKKKGSYVLNAIGL
FT                   TNEEINGTIRFSLSDMNTEEEMLEAVKVLKESICDLRSIMKRK"
FT   CDS             845845..847020
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="CDR20291_0682"
FT                   /product="putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02652"
FT                   /db_xref="GOA:C9YJD2"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD2"
FT                   /protein_id="CBE02652.1"
FT                   /translation="MVYNILIVKYGEIGVKGKNRYIFENRLIRNIRNMLKPIGRFNVYK
FT                   EYGRIYVDLEDYDYEEVIEEVRKVFGIVGVCPGVRAKKDYDTLKEIALKMLEEKIEAGY
FT                   KTFKVESRRGDKSFGLTSQEMSMDIGGYLLSKVGDRINVDVRNPEVKIKCEYREFHTMV
FT                   YSDTIPGYGGLPLGTNGRAMSLLSGGIDSPVATWMVAKRGMEVEAVHFHSYPFTSERSQ
FT                   EKVKDLAKILAKYCGRVRLHKVNILEIQKAIGENCNEEEATILSRRFMMRIAQRLSEKR
FT                   HCDALITGESIGQVASQTIQGLTCTNAVVDLPVFRPLIAMDKSDIVDIAKKIGTFETSI
FT                   VPEEDCCSVFSPRKPVTKPRLEKIEKSETALDIEKLVQDAIDKIEVEDIEF"
FT   CDS             847161..847979
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0683"
FT                   /product="fimbrial protein (pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02653"
FT                   /db_xref="GOA:C9YJD3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="PDB:4IXJ"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD3"
FT                   /protein_id="CBE02653.1"
FT                   /translation="MGMIIMNKKGFTLIELLVVISIIGILVIVAVPALFRNIEKSKAVT
FT                   CLSNRENIKTQIVIAMAEESSKDKNEVIKEVLENKDGKYFETEPKCKSGGIYSATFDDG
FT                   YDGITGIESIAKVYVTCTKHPDGIEMARDIHQSMKDLIASFAQDPSIIPGASKGNDDFR
FT                   KYLLDNKYKNGWPTIPDEFKAKYGLSKDTLYIQPYAYNPTKSDATVVVFANNKTGGNWY
FT                   TSLVYDYDEGRWYKGKNGISVAGRSWDVDTDSVKSVKTEIHSKEGWGPLN"
FT   CDS             848222..848863
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0684"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02655"
FT                   /db_xref="GOA:C9YJD4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD4"
FT                   /protein_id="CBE02655.1"
FT                   /translation="MNNNFQDNQTINLIQSRRSIRKFTTEQISDEQVNTLLHCAFAAPS
FT                   GCNKQPWHITVVQDQKLLKEISDDTLSRIHEVSNVEINKNFKLFYGAPTVLFISYDESS
FT                   SWAPYDIGILTGNITTAAQALGLGSCIIGMVRGLFTPVEQGDIEGLVSVLDKEDVKESE
FT                   SIKMKFDTNKKYRELLDIPEGYSVPFGIAVGIPDGNLPNAREVVYKVSRV"
FT   CDS             850276..851946
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0685"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02656"
FT                   /db_xref="GOA:C9YJD5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD5"
FT                   /protein_id="CBE02656.1"
FT                   /translation="MREESNSLSLDHIEIFFELLSQSTEDYIFFWDINRNKFKISSAIF
FT                   DEFNLSKEIESDLVNCWSKIVYPDDVQIWKDDIQELLHGKKGEHNLEYRLINKYEEIVW
FT                   ISCRGKVYVSDDPKTIFLVGRIKNIGEKNKFDSITGTWNREQFEHRMNYLIKEKIYKNG
FT                   AMFIMDIDNFKNINEKYGHSYGDKVLRAIATEVLEYLPKDVRLYRLDGDEFAFFYPMCT
FT                   KETIEKIYEKIQMYTNTQHEIESNKYYCTVTAGVAMYPEDGDNYLDLFKHADIALDIAK
FT                   ISGKNRIKFFSQELYENKLKVISMQQKLRECVENNFNDFELFFQPQVNAVTKEVIGAEV
FT                   LLRWHSSTYGEVSPVEFIPILEQSNLIIPVGKWIIKEAVKQCKEWHKINPDFKISVNVS
FT                   YIQLKEDFFRDFIVECLVEYQLRPEFLILELTENCWIPDINLLNDKFISLKGIGVYIAI
FT                   DDFGTGYSSLNYLKELSVNIIKIERSFVKNITYNSYEYTFLEYIIKLAHIINLKVCVEG
FT                   IESYEEYDIVKSLGVDIIQGFLFGRPVSASEFYKFQLSK"
FT   CDS             complement(852068..852802)
FT                   /transl_table=11
FT                   /gene="plfA"
FT                   /locus_tag="CDR20291_0686"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02658"
FT                   /db_xref="GOA:C9YJD6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD6"
FT                   /protein_id="CBE02658.1"
FT                   /translation="MIKGKIHSIETFGTVDGPGIRYILFFQGCPLRCKYCHNRDTWDIK
FT                   SGKEYTVDEIITDALKYTSFMKFSGGGITASGGESTLQPEFLSELFKKAKENDIHTCLD
FT                   TSGFVDIETIDPVLDNTDLVLLDLKHMVEEKSIDLTGVGMDKALKLARHLESRNIPVWI
FT                   RHVLVPGITDDIDNLEKLGQFVATLKNVERFELLPYHSMGIHKWESLGIDYELKDVPDA
FT                   TKEDVQKASEIISKFGVKVYNS"
FT   CDS             complement(852962..855193)
FT                   /transl_table=11
FT                   /gene="plfB"
FT                   /locus_tag="CDR20291_0687"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02660"
FT                   /db_xref="GOA:C9YJD7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD7"
FT                   /protein_id="CBE02660.1"
FT                   /translation="MNAWQGFKTGRWTKEINVREFIQLNYSPYEGNDSFLAGATENTKK
FT                   LWDEAMVLFKKERENGGTLDVDTKTVSGIAAYAPGYLDKELETIVGLQTDAPLKRAVMP
FT                   YGGIKMVENSCEAFGYELDPEIKDIFTKYRKTHNQGVFDVYTPEMRAARKSGIITGLPD
FT                   AYGRGRIIGDYRRVALYGVDALIEDKNEQKKSLEVSCMDEEVIRLREEITEQISALNEL
FT                   KKMAESYGFDISKPATNSKEAVQWLYFGYLGAVKDQNGAAMSLGRTSTFLDIYFERDLK
FT                   AGIVTEEELQEYMDHFVMKLRMVKFLRTPDYNNLFSGDPTWVTECIGGMGIDGRTLVTK
FT                   NSFRMLNTLYTLGPSPEPNLTVLWSTKLPQGFKDFCSKVSIDTSSVQYENDDLMRAYWG
FT                   DDYGIACCVSAMRIGKQMQFFGARVNLAKTLLYAINGGVDEKSGVQVGPRFEPITSEYL
FT                   DYDEVMSKFEPFTDWLATLYVNTLNVIHYMHDKYSYEALEMALHDRDIFRTMACGMAGL
FT                   SVCADSLSAIKHAKVKTIRNEQGIAVDFEIEGDYPKYGNNDDRVDSIAVELVESFMNKI
FT                   RKNKTYRNSYPTQSILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDTNGALAS
FT                   LSSVAKLPYEHAQDGISNTFSIVPAALGKDMTERINNLSAMMDGYFSQNAHHLNVNVFD
FT                   RATLEDAMEHPEEYPQLTIRVSGYAVNFIKLTKEQQLDVINRTFHGKMA"
FT   CDS             855486..856547
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0688"
FT                   /product="Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02661"
FT                   /db_xref="GOA:C9YJD8"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD8"
FT                   /protein_id="CBE02661.1"
FT                   /translation="MEKRKSIHLHKLNIYLIGGGDRLFITVVLFLVGFLLITKGADIFI
FT                   NCTVEIGRKTNISEIILGATIVSFATTLPEFTVSLLASIDGHTTMSLGNAVGSIICNTG
FT                   LALGLVVFISPFNVDKKMFFSKSLLLIVSVIVLILLSLDGVITRGDSLLLIIILIFYMV
FT                   NNYRSVVGKSDTKNRNIKNNTIKDISTKKGKNYRGFSVLEIVKILLLFATGLIMMIIGS
FT                   QILIESGVIIASFLNIPQGIVSLTIIALGTSLPEIVSSITAIRKNHHEISVGNILGANI
FT                   LNIVSVIAVSAIPNNIPILSQNRQLDIPFMILLLLIVIIPTLKSNRLSRIQGILMLFTY
FT                   FLYISILYFMYII"
FT   CDS             856638..858251
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0689"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02663"
FT                   /db_xref="GOA:C9YJD9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJD9"
FT                   /protein_id="CBE02663.1"
FT                   /translation="MNITKFEDLPISEGIKKAIAEMGFEEPSPIQAQSIPAILSGKDVI
FT                   GQAQTGTGKTAAFSIPILETIDPNNRSLQAVVLCPTRELAIQVSTEIRKLAKYSHGIKT
FT                   LPIYGGQPIDRQIKSLKSGVQVVIGTPGRTIDHINRKTLKMDNVKMIILDEADEMLDMG
FT                   FREDIEMILSKIPEERQTTFFSATMPRGILELTKRYQKDPEHIKVVRKELTVSNTKQYY
FT                   IETRSSNKLEVLCRLVDVYDPKLSVVFCNTKRKADELVGDLQARGYFADALHGDLKQTQ
FT                   RDIVMDKFRNGTIDILVATDVAARGIDVDDVECVFNYDLPQDEEYYVHRIGRTGRAGRE
FT                   GMSFTFVFGKEMRKMKDIERYTKSKLIKHNIPTITDVEEKKVGTFFAQVKQTIEEGHLT
FT                   KQLQWLEGFCNDEDYAMVDIAAALVKLSLGEEMKEEIIEEKPRRERGDRKGGTGAKDGM
FT                   IRLFINIGRNQRVQAKDIVGAIAGEVGIPGKVVGTIDIYDKYTFVEIPKKDAKTVIEKM
FT                   KDIKIKGNKINIEKANKKKK"
FT   CDS             858526..860511
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0690"
FT                   /product="putative transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02665"
FT                   /db_xref="GOA:C9YJE0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE0"
FT                   /protein_id="CBE02665.1"
FT                   /translation="MSMTYMDPRVFLILEMVLEEDTNTLEQFSNVLGVSTRTIRNYINQ
FT                   INRELKGGIAKIVKNEKGTYSIRIEDESKLIEIVNFNRGKLSNFINLNSPDERINYVLD
FT                   ILTMTNNPITIDDLAEEICIGRTTLIKDLKKADRILAEYDLELKRKPNIGMILVGEEMD
FT                   IRLLILDRLYENYIDVLENVNQINLVKDYDIECLRDELKKLFKKEELYITEQVLRDVER
FT                   YIIMSVLRNLNGYKFEKIDKRFEVIRCSDEYTLGLKLKALLEKIFNIVLNEKETIFLTM
FT                   PLIGRKAPSTKLALSSIKINDSVKEVVDEVTSFLLETSGIDFKEDKKLIENLEYHLYFA
FT                   LNRMRFNIRVKNPLLQEIKERYTFPYSVAKIAAMIIEEKFDLKICDHEIGYIALHFGSY
FT                   FEKNSRKVLNVNRVAVVCGTGLGTAQLIRIKIGKILGESVEVNTFSDIEAKANLDLLKY
FT                   YDLVFTTVDFKTDLDVPIFRVNALFNEESIKKEIENAILLKNSINLKSIKKIEKNIPFI
FT                   GKLIEEDKFFILNKSTFMENLEDMLEKLVHKGIIDIEFKKKVLKREKKSSTALDNYIAL
FT                   PHSVNTNGENLYLSFGILEKPVVWDTKEIRIIILMIIPDKNVDSTDLIIKSYEEVLEVG
FT                   RDKKMIEELAKVKSFDEFYKIITKRR"
FT   CDS             860516..860950
FT                   /transl_table=11
FT                   /gene="gutM"
FT                   /locus_tag="CDR20291_0691"
FT                   /product="glucitol operon activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02667"
FT                   /db_xref="InterPro:IPR009693"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE1"
FT                   /protein_id="CBE02667.1"
FT                   /translation="MDPVIFIIASLITVYLLNIFLGYLQLKDFNKNYIELKRKGRVAIG
FT                   RKKGRISSGTIVLILINDDGVIVETRKMQGVTVLARVKSFEGLVGKSLEYIEKSDLTVY
FT                   NKLLKKAILDAVKQYITFEKNKCEDTNNLSTDEECRMEVV"
FT   CDS             860979..861539
FT                   /transl_table=11
FT                   /gene="gutA"
FT                   /locus_tag="CDR20291_0692"
FT                   /product="PTS system, glucitol/sorbitol-specific IIc2
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02669"
FT                   /db_xref="GOA:C9YJE2"
FT                   /db_xref="InterPro:IPR004699"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE2"
FT                   /protein_id="CBE02669.1"
FT                   /translation="MTQFFQVLASGADSFMNLFRAGGQQFVGFVTDIVPLLVALLVTMN
FT                   AIINFIGTDRVERLAKKCSANIFTRYLILPVLGTFVFANPMTLSLGRFLPEKFKPSYFA
FT                   AASFSCHTMNGLFPHINPGELFIYLGIANGITTLGFSTADLAVRYLLVGIVANFIKGVV
FT                   TDYTTKFVEKQQGIALNSDIKIG"
FT   CDS             861603..861971
FT                   /transl_table=11
FT                   /gene="srlE"
FT                   /locus_tag="CDR20291_0693"
FT                   /product="PTS system, glucitol/sorbitol-specific IIb
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02670"
FT                   /db_xref="GOA:C9YJE3"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE3"
FT                   /protein_id="CBE02670.1"
FT                   /translation="MAFNKVKIVKGSGGWGGPLIIEPTEKKNKVVYVTGGAKPETAVKI
FT                   AELTGCELIDGFSQGVKDDEIACVIINCGGTLRCGIYPQKKIPTINIMKTGKSGPLAMF
FT                   IKEDIYVSGVKPTNVEQL"
FT   CDS             861996..862562
FT                   /transl_table=11
FT                   /gene="srlE'"
FT                   /locus_tag="CDR20291_0694"
FT                   /product="PTS system, glucitol/sorbitol-specific IIc
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02672"
FT                   /db_xref="GOA:C9YJE4"
FT                   /db_xref="InterPro:IPR011618"
FT                   /db_xref="InterPro:IPR011638"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE4"
FT                   /protein_id="CBE02672.1"
FT                   /translation="MAYDTKKKISEQSQGIVAKIGIALGNVTSTLFQAGRDTIDTLIHT
FT                   ILPFMAFVAVLIGIINQSGIGNWVANLLTPLIGNVGGLVVLSIICSFPLLSPFLGPGAV
FT                   IAQIVGVLVGTEIGKGNIPPSLALPALFAINSQAACDFIPVGLGLAEAEPDTVQVGVPS
FT                   VLYSRFLTGAPTVLLAWLASFGLYK"
FT   CDS             862603..862968
FT                   /transl_table=11
FT                   /gene="srlB"
FT                   /locus_tag="CDR20291_0695"
FT                   /product="PTS system, glucitol/sorbitol-specific IIa
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02674"
FT                   /db_xref="GOA:C9YJE5"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE5"
FT                   /protein_id="CBE02674.1"
FT                   /translation="MELIYSTQINKIGDNANEFLQHNMFVTFKDNAPQELENYCYIHSE
FT                   NNLVKEILTNDVLSINNVDYKITSVGELVNQNLSELGHITFKFTGEKDGAIGGTLYLEE
FT                   KEIAPIGVGTILKIIRK"
FT   CDS             863063..863842
FT                   /transl_table=11
FT                   /gene="gutD"
FT                   /locus_tag="CDR20291_0696"
FT                   /product="sorbitol-6-phosphate 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02676"
FT                   /db_xref="GOA:C9YJE6"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE6"
FT                   /protein_id="CBE02676.1"
FT                   /translation="MKMRKVALVVGGGRSLGEYLSKHLAKVGYDVAIADLNEDNAKKVA
FT                   EEIETEFGCKSVGYGCNAIDERQVISTVKAIENDFDRIDLLVYNAGVAVSKKITDFGYK
FT                   DFKFIVDVNLNGYFLFAREVSKVMIAKGIEGRIIQINSKSGRVGSKHNSGYSAGKFAGV
FT                   GLTQSLALDLAEHKITVNALMLGNLLDSDMFESLIPQYAVKLGIPESEVKQVYIDKVPL
FT                   KRGCRFIDVANMLTFYASKEAEYCTGQSINITGGQVM"
FT   CDS             864835..865953
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0697"
FT                   /product="transposase-like protein b"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02677"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE7"
FT                   /protein_id="CBE02677.1"
FT                   /translation="MIVVEKAYKFRMYPNKKQQELINKTFGCCRFVYNKYLAKRIEVYK
FT                   NAKETFTYKQCSSDLTNLKKELNWLKEPDKFSLQNALKDLDNAYKKFFKEKAGFPKFKS
FT                   KKINRFSYKTNFTNGNIMYCGQHIKLPKLDMVKIRDKQVPKGRILNATISKEPSGRYYV
FT                   SLCCTDVDIEAFENTNNQIGLDLGIKEFCISSCGEFIENPKYLKKSLNKLAKLQRELSR
FT                   KTIGSLNRNKARLKVARLQEHIANQRNDFLQKLSTKLIKDNDIICIEDLQVKNMIRNRK
FT                   LSRLISDVSWSEFIRQLEYKANWYGRQIVKVGKFFASSQICNKCGYKNEEVKDLNIREW
FT                   ICPSCNETHDRDINASINILKEGLRLITIQNK"
FT   CDS             866179..868491
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0698"
FT                   /product="putative formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02679"
FT                   /db_xref="GOA:C9YJE8"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE8"
FT                   /protein_id="CBE02679.1"
FT                   /translation="MDIIKKLSHGCTLDCHDCCKFNVYTKENNVVKIEGDKNHPYTKGF
FT                   ICKKGMAHLDRLNHKDRIKTPMLKVDGVWKEISFDKAIEIMAEKLTYYKEKYTSKSVMH
FT                   YDQYGSGSVLKYIGDIFFNFYGGVSRHKGGPCWSAGMHAQKYDFGVAKSHAIEDMLNSK
FT                   SIFVWGKNPAYTTIHTMQIIKKAKEKGIKIVVIDPIYTKTAQIADKYVQVNPGTDGALA
FT                   IAMAKIIVEDKLYDEEYINSYVIGFEEYKKYLSSLELSFLIDECGVKENDIRELVDLYT
FT                   NKYSSINVGYGLQKYKNGGNTIRAIDALGAITGQIGFSGGGVNYANKVYPSVINSDPYN
FT                   SQSYGEDREFYVSNISKFIEESLKNTSNKVNYASDELDTTSNKVNYISDELDTTSNKVN
FT                   YVSDELDTTSNKVNYVSDELGMALHKVNCVSDELDMTSNKVNYVLDELDITSNKTDYIS
FT                   NELYNLSNKSIKDNIPIKMAVITKSNMLNQLPDLVELERVFSKIKFKVCFDMFMTDTAT
FT                   LCDMFIPCTNTLESEDIIYSSMTNPYITYNERAVKPAHKLMDEYYFFMELAKKMGLNDY
FT                   PFVEKRTYLEKVIEPLKRFDKNLDIEKLKNNYFTIHNLVAWEDKKFETPSGKYELYSES
FT                   IKNLGISPTPVYISNKYKEIEDKNISFRLLTNHHADTLFSQHFMDKKSIAQAYINQRMA
FT                   KKVGIEDKDIVILRSKKAKINVQINIDDGVGNYIVKMYVGWWKKHGNPNSLTDTGISDF
FT                   GGQVTYNESMVEIIRQN"
FT   CDS             868579..868914
FT                   /transl_table=11
FT                   /gene="spoIIAA"
FT                   /locus_tag="CDR20291_0699"
FT                   /product="anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02681"
FT                   /db_xref="GOA:C9YJE9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR014237"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJE9"
FT                   /protein_id="CBE02681.1"
FT                   /translation="MVNYSLEHKNLYIEFMCSELDHHVANEIREEIDNLLSVNQVKNVV
FT                   FNFENINFMDSSGIGVIIGRYKKISNEGGRVSVINISSRVKKIFDLSGLNKIIGIYDTY
FT                   EEALSSL"
FT   CDS             868928..869356
FT                   /transl_table=11
FT                   /gene="spoIIAB"
FT                   /locus_tag="CDR20291_0700"
FT                   /product="anti-sigma F factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02683"
FT                   /db_xref="GOA:C9YJF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF0"
FT                   /protein_id="CBE02683.1"
FT                   /translation="MNNIMEVKFSAISENESLARVIVASFAAKLDPTVDELVDIKTAVS
FT                   EAVTNAIIHGYEEDSSKFVFLRCEIEGNTIKIIVEDEGYGIENVEKAMEPLYTSKPELD
FT                   RSGMGFTVMKSFMDDVEVSSVKDNGTRIEMTKKINVPK"
FT   CDS             869379..870143
FT                   /transl_table=11
FT                   /gene="sigF"
FT                   /locus_tag="CDR20291_0701"
FT                   /product="RNA polymerase sigma-F factor"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02685"
FT                   /db_xref="GOA:C9YJF1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014236"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF1"
FT                   /protein_id="CBE02685.1"
FT                   /translation="MEVTVAREEKKPLLSHEETLELIEKVQNGDEEAKEILISSNLGLV
FT                   RSVVSRFLNIGYDREDLFQLGSIGLIKSIYKFDPKFNVKFSTYAVPMILGEIKRYLRDD
FT                   GMIKVSRSLKQIAVKAKMESEALTKKLGREPSIEELAKAIDVEKEDLVMAMEANFNVEY
FT                   LQGVIHEEEGSPICLIDKISMKGESEEEKVVDNILLKDILGRLDKRERQIIVLRYFEDM
FT                   TQSEIGEMLNISQVQVSRIEKKVLSKLKEYIS"
FT   CDS             870423..870860
FT                   /transl_table=11
FT                   /gene="spoVAC"
FT                   /locus_tag="CDR20291_0702"
FT                   /product="stage V sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02687"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014203"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF2"
FT                   /protein_id="CBE02687.1"
FT                   /translation="MDKNYKKYVDQISPKPTYLKNYTLAFIVGGIICMIGQAINDLYMK
FT                   VGGLDKLGASSATSITLIFIGAFLTGLGVYDLIGKRAGAGSIIPITGFANSIVSPAMEY
FT                   KREGYVLGVGANLFKIAGPVLVYGIGSSILCGIIYYIFKMF"
FT   CDS             871014..872027
FT                   /transl_table=11
FT                   /gene="spoVAD"
FT                   /locus_tag="CDR20291_0703"
FT                   /product="stage V sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02689"
FT                   /db_xref="GOA:C9YJF3"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF3"
FT                   /protein_id="CBE02689.1"
FT                   /translation="MKNKRIGKRTVKLENKPTIISTGTIVGPKEGEGPLKDYFDMIMTD
FT                   DLYGEKTWELAESKMVETASQQAIQKAGKKLSDVNYMLGGDLINQIVPASFAARELAIP
FT                   FLGIYGACSTMAEGLCIGSMLIDGGFADLVLSGTSSHYCTAERQFRFPLELGNQKPMTA
FT                   QWTVTGAGSVLLAPNGDGPKVKYVTVGKVIDEGIDDGNNMGPAMAPAAIDTIYSYFEDT
FT                   NDDPNSFDIIATGDLGTLGKQIAEDFLKEKGVDISKVYTDCGIEMFNLKEQDVHCGGSG
FT                   CGCSATVFAGYIYDKLRKKEFNKVMLVSTGALLSPTSTLQKQTIPCVAHAVVIVNE"
FT   CDS             872041..872403
FT                   /transl_table=11
FT                   /gene="spoVAE"
FT                   /locus_tag="CDR20291_0704"
FT                   /product="stage V sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02691"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014204"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF4"
FT                   /protein_id="CBE02691.1"
FT                   /translation="MLMDYVRVFIVGGIICLIAQVMMDYFKMQTPYVMVTYVTTGVVLT
FT                   FLGLYEPLVKFAAAGATVPIIGFGYSLATGVIKSIQSDGFLGIFLGGTTATAGGIAAAI
FT                   FFGYIMSVVFTPKAKP"
FT   CDS             872586..873602
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0705"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02692"
FT                   /db_xref="GOA:C9YJF5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF5"
FT                   /protein_id="CBE02692.1"
FT                   /translation="MVTIKDIARNLGISYSTVSRCLNNNPNVSEKTKKKVVEEANRLGF
FT                   HFNVNARNLAKKETNRIGVIFSNNFNHQDTRKFFSDIMDSSINSIETNKYDFIIQPNNN
FT                   ISGDSNVYKMVNGQMVDGLVIVSQSIKKEEYDFLKDNNFPHVFIYFKPSFVGEVDNFFW
FT                   DDNVYGGYIATKHLIDHGHKDIITVTSDDRSSKMHEDRTKGYLNAMEEANLKTEVIKSK
FT                   MDFESQVEFLEKYIDKIKKASAIFVQQDVPAISIIQELKTTYGINVPEDISIIGYNNIE
FT                   LISYFRSHLSTIDDPREQVIKNGVDSLVNIINKKSTEHIPRKLYPRLIIRNSVKRIK"
FT   CDS             873977..874819
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0706"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02694"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF6"
FT                   /protein_id="CBE02694.1"
FT                   /translation="MKEKAGIRNAIIAAFIITILAELIGPISFKVMGINVTLLSILWAI
FT                   FIGMAVSPHLLGRVIPALKKFIGDNEINVSPYLLSLTLYPLGIMFGINAGPKVGILLQA
FT                   GPALLLQEFGHMGTMLIALPVGVALGLGRSALGGTFSLCRDTALGIIGDKYGLNSPEGI
FT                   GTLGTYISGSIFGTLLFSFLAPVGVLLGFHPYALAMASGMGSGSMMGAATASLMNTVPQ
FT                   MSEQILAYSATSGLITAVTGIYIELFLSLPVANYYYSKVAPVIERFRGRKTRRTSNKL"
FT   CDS             874834..875298
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0707"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02696"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF7"
FT                   /protein_id="CBE02696.1"
FT                   /translation="MEKTFKTIMEQIKIVLFIYIITCFGQMIALKTQAQDLLIGSISGF
FT                   LLVIIAIIIKNFVKKPNLPGFAWATLVAFVLSLPISPVGDIIATNVGKINFMSTVTPLL
FT                   AFAGISVGNQLDILKTLSWKLVVISFIVMTSTYFGSAFISQTVLRLNGML"
FT   CDS             875285..876457
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0708"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02698"
FT                   /db_xref="GOA:C9YJF8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF8"
FT                   /protein_id="CBE02698.1"
FT                   /translation="MECFKEVVNMNELKAKIKEEIKLLSEEKKTSFEKVSDYLFSNPEL
FT                   AFEEYKSQKALCDLLEENEFNVTKGVGGLETSFEAVYSNGTNGKTVAFLAEYDALPGMG
FT                   HACGHNIIGTSSVGAGIILKEIMKKHNIEGTVKVFGTPAEERVGGKITMIKEGVFNNVD
FT                   AALILHPSDASMPDDISFAQVNLKFDFTGKASHAAAFPWEGKSALSGVIALFNSVNSMR
FT                   LHLKDYARVHGIITDGGSIHNIIPEKSTAIFNVRALSIEYLNEICEMLKNCAKGAAIST
FT                   GTNVEIVQLDEIYKEIKNDSELVNIVRQNFEVLGEDYVERDLSQGIGSTDTGNLTHEIP
FT                   AIQAYIKLKENTATHTDEFAVAAGGEEGKVALIKAIKVLAMCGVDILYSK"
FT   CDS             876501..877436
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0709"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02700"
FT                   /db_xref="InterPro:IPR009561"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJF9"
FT                   /protein_id="CBE02700.1"
FT                   /translation="MILKQVIEVYDILDKANANGEEVKTYLQGYGEVDVTVKELSSSKG
FT                   STDLVKLTIPGKNGKLKGGDAPTLGILGRLGGIGARPEVIGFVSDGDGALVAIAVAAKL
FT                   LDMQRKGDILDGDVVISTHICPDAPTKEHYPTPFMDSPIDMMTMNENEVDSSCDAILSI
FT                   DTTKGNRVINTRGFAISPTVKEGYILKTSDNLLDIMQTVTGKSPFVFPLSIQDITPYGN
FT                   NLYHLNSILQPAVATDAPIVGVAITTEMPVAGCATGATNFSDLDSAGRFAIEVAKLFGR
FT                   NKCDFYDKEEWEMLIKRYGKLNRFQTFGIQ"
FT   CDS             877775..878176
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02701"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG0"
FT                   /protein_id="CBE02701.1"
FT                   /translation="MGTTKQKINKPLCGLLTCLLYYTFPKTASTMGGYKAATIQGRSPR
FT                   NRDRVPMWDIIKSAPEVSTTIRGALYYVPWEPCPRSRAYNGQIGPTLLTDWNLNPIENN
FT                   HNNHGKIIYTPVKYFCVYHEVLLATIENG"
FT   CDS             complement(878235..878699)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0711"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02703"
FT                   /db_xref="GOA:C9YJG1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG1"
FT                   /protein_id="CBE02703.1"
FT                   /translation="MCLRRKRRIKDYLYGYNRRINLMKWKELYNNARGKLNPRTISPFI
FT                   DAGGVAAAILTDSGNVYTGVCIDTACTLGMCAERNAIANMITNGESKITKLVCVMSNGS
FT                   VGSPCGACREYLMQLDKDSACIEILVNVETEKTVKLSELLPDWWGSDRFI"
FT   CDS             complement(878932..881625)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0712"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02705"
FT                   /db_xref="GOA:C9YJG2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG2"
FT                   /protein_id="CBE02705.1"
FT                   /translation="MNNDNDKNGNKIRRKKVSSSGNTNKPINRTSANKTRSTKNKKKSK
FT                   KSDKFKKLRVFGIVFLVLLVVGTAGTAGLVFASLRDVTPVTEAVLDKQTNQTTTIKYAN
FT                   GKTLSTAPSVNKKTPVPLDKISPYLQHAVIAIEDERFYEHKGVDIKGLFRSVLKTLTGT
FT                   KQGGSTIPMQVSKMLLTTEQQTIPRKIKDIYYAHEMSKTVSKDKILETYLNNFFVGRGL
FT                   AGAEAGARGYFDKSAADLTLAESALLAGSTKNPSRFSAYKTSKLEGNETKEDLENKLLF
FT                   FVNTTDDDLDDPTQVDFDMIEKIKSWELISNDTYRQLKAGTLVVRKAVSNPEAKKRQEI
FT                   VLKKMLELKYIKQSEYDEAIKAKIEIKLPQSSDKVSSSVEDLIESEVINALMEQGHTND
FT                   EAQNLFYNGGLIVNTTIDPKMQDALEEEFDRNSNFPGHMVGPDGVSQPQAAMVILDYKN
FT                   GEIRALAGGRNISGRKTLNRATNPHQPGSSIKPLAIYTPAIDTLKITQSTALSDSRGGY
FT                   KFEENNKWNPRTTTAGHGSMSLRKALAKSSNTIAVKTAEMLGDSYDECVDIMMDYLKNF
FT                   GITTLKNNHSGSSEASDRKFPSLTLGGMANGITPLQMAAAYGTLANQGVYVEPSIFTTI
FT                   TTFDGQLLVKNAPEEHKVVDPEVAYVVTDMLESVITEGTGGVATLPKGMPVAGKTGTTN
FT                   SAYDAWFVGYTPYYVGATYIGDDAGRKDDSGNTIKRREVPHGSTSTAKLWEKIMEKIHA
FT                   NLTVTEFEVPKNVYFTKINLEDGGKQSSGSKAAFIEGTAPTKVSSQPSSEDTKKPDNNQ
FT                   PEENNNNNNNTGDNGGGSTPPDNGGNNGGGSTTPPDNGGNNGGGSTTPPDNGGNNGGGS
FT                   TTPPDNGGNNGGGSTTPPDGGGTPAT"
FT   CDS             881839..882537
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0713"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02706"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG3"
FT                   /protein_id="CBE02706.1"
FT                   /translation="MNRIVDRKTKNEFRKIIAIFLVILFLSVFIGSFIYIDKTLRPTIT
FT                   VLAETKALELANRSINKAVAEMVEGKINYEDLMDIQLDNNGKITMIQANTIMMNEIASA
FT                   IALEIQDELKKDKTASSYIPIGTALGSPILAKYGPKLEVSIEPIGTVSVNFKTEFESSG
FT                   INQTRHRIYLEAQTQVKVVIPLITSTKQIKAQIPICETIIVGDVPESYVNIPEKNLGNV
FT                   LPNTGKNTNK"
FT   CDS             complement(882749..883756)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0714"
FT                   /product="putative stage IV sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02708"
FT                   /db_xref="GOA:C9YJG4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG4"
FT                   /protein_id="CBE02708.1"
FT                   /translation="MQLKNFHFKNNTLSKKTNLAKSKFTIVLTFLFLLYFFSNNLIYAQ
FT                   NLQKNEPEYLIPIGNVLQIDAELKNIIVRNPGEASPFRLGDAIVKVNNSEVDGYSDFAN
FT                   TLNALPEEKQVSILLNRGGQLITMKTTKHILEKISFNNLLSGFATLTYINPDTSEFGAV
FT                   GHPISVGNARKIPIKTGSISTTKHLNIEKSYKGSVGCINAKRENIIGSFTENTDFGIRG
FT                   QINNFDISNLKKYKVASLDEVKLGKAQIILQDNFNKCKKYNIEIIDIENQKHPESKSFK
FT                   IKITDKKLLAQTGGIVQGMSGTPIVQDNKIIGAVSHAIENDPAVGYGVFIKWML"
FT   CDS             883984..884868
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0715"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02709"
FT                   /db_xref="GOA:C9YJG5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG5"
FT                   /protein_id="CBE02709.1"
FT                   /translation="MKKYRLLVTCIIAMGIIIIGTSNPVSNFYKTTNLISSGNITNEKA
FT                   DKDENSNKNNKDKNEDKSNSKSNKDKSSEDKSSDKKNKIQKNKKLLICIDPGHQGKGDS
FT                   NLEPVAPGSSSKKARVSSGTEGIATKKPEYVLNLEASLVLKSILESKGYNVIMTRETHD
FT                   VNISNSERAILANDKKADMVVRIHADSLNNSSKTGASILIPEKDGKYTAPIYEESNKCA
FT                   EFIKQNMEQSGIQINGIVQRGDLTGFNWSKVPAVLVEMGFMSNYNEDQMMSNPDYQRKM
FT                   MQCIADGLDAYFK"
FT   CDS             885040..886620
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0716"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02711"
FT                   /db_xref="GOA:C9YJG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG6"
FT                   /protein_id="CBE02711.1"
FT                   /translation="MCKIFLRGVEMLVVENVSHGFGARTILENVSFRLRKGEHIALVGA
FT                   NGEGKSSFLNIITKKLMPDAGNIKWSSRATVGYLDQHTVLSKEKTIREVLREAFKHMFD
FT                   LEQEMIAMYDKMGEASDDEMSKLLEETAEIQTILENSGFYMIDAKIQEVANGLGLGEIG
FT                   LDKDVTDLSGGQRTKVLLTKLLLENPTILILDEPTNYLDEEHITWLTKYLQEYENSFVL
FT                   VSHDIEFINNTCNVIYHMENGELNRYKGNYDEFVRLNDIKKRQEEQAYDKQVEERKRLE
FT                   DFVARNKARVATRGMANSRQKQLDKMEILERPKEKIKPTFAFKDARAASKIIFETENLV
FT                   LGYDEALTKPLNFHLERGKKIALKGMNGIGKSTLLKTLLGIIKPFEGNVKLGDYLEVGY
FT                   FEQESSRENSNTPMDEVWSEFPGLTNFEVRQALAKCGLTNEHITSQMRVLSGGEAAKVR
FT                   LCKVMLKNINFLVLDEPTNHLDVEAKDELKKAIKEFKGTVLLVCHEPEFYSEIVDDVWN
FT                   IEDFTTKIV"
FT   CDS             886649..887284
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0717"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02713"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG7"
FT                   /protein_id="CBE02713.1"
FT                   /translation="MKKFLNVLFSVCISIVIIVGVINFTVGFKQLYYFDIDYLNISELS
FT                   GLSEDDIKLNYDYLIDYNLNKNVSEFKLPTLKSSPQGKIHFEEVRNIFQNINKLAKLLL
FT                   VVFLVGIILSVKNKNIKILKTTSITLIIMPLLLTVPILLNFEKSFIIFHKLLFRNDYWI
FT                   FNPNLDPVINILPEEFFFHSGMMILILILLASILLFVMYRLYKSFKIK"
FT   CDS             complement(887395..887655)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0718"
FT                   /product="putative metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02714"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG8"
FT                   /protein_id="CBE02714.1"
FT                   /translation="MGENYKFFNHKDCEFFPCHKTNKPEEFNCLFCYCPLYALGENCGG
FT                   NFKYTDKGIKDCSSCMLPHKKDNYNYIMGKFQDLVKITSKK"
FT   CDS             887872..889155
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0719"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02716"
FT                   /db_xref="GOA:C9YJG9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJG9"
FT                   /protein_id="CBE02716.1"
FT                   /translation="MKEIQEKALLVGLNLTTIVKKNDDIDTSESMEELKELTKAAGAEV
FT                   VGSLIQNKHSVDAAYYIGKGKVEEIRAYSDSLDATLVIFNDELSGAQIRNIENVVGRKV
FT                   IDRTTLILDIFAQRALSKEGKLQVELAQLKYRLPRLYGMGGEMSRTGAGIGTRGPGEQK
FT                   LEIDKRHILNKAADIRRELKEVKKNRETQRVKRLKSNIPIVALVGYTNAGKSTLLNELI
FT                   KTHKDYEQEKEVFVKDMLFATLDVTLRKALLPNKKEFLVVDTVGFVSKLPHDLVEAFKA
FT                   TLEEVQYADLILHVIDATNTSYELQKSTTEGVLKELGVNDKKHILVYNKVDKLELDIYP
FT                   KSQEDIVYISAKQGINMDKLLNMIEIALMENTYSVSLMLPYERGDIFSRIKDKYNVENF
FT                   EYGENGITLDVNFDEEDFNIYREYILEK"
FT   CDS             889163..889840
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02718"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH0"
FT                   /protein_id="CBE02718.1"
FT                   /translation="MDINWENIDNLEDYFITYLLYKESKTVSQISKIRNISSTEAGEQL
FT                   IQAKLKIKEMQKDDFEASKDILDKFLELDKIKRLDFMDSLDDEKMVYFKRKVFKRILVE
FT                   KNAEDLIVLIWATGELKDDRFLKLLHQLTNHRHSDIRRITYSAIRKIESPSSREVLQKG
FT                   LYDKNAQTRQYCAKALSKLGDENSLKILQQLKDKNKNFEKEYVLRAYDEAIKSLENAKN
FT                   LKK"
FT   CDS             889926..890369
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0721"
FT                   /product="putative NUDIX-family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02720"
FT                   /db_xref="GOA:C9YJH1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH1"
FT                   /protein_id="CBE02720.1"
FT                   /translation="MIVRRCAGGVVFYANKVLIVKNDRGEWTLPKGKILGGGLPYESAV
FT                   QRVKVETGIDAKMIDVAGDTMYEFFSRSRQQEVCNAIMWYVMEACNTNCVLAPEFQEGG
FT                   FYKVKDALDMLSHHKEQALVEVSYKKFKELKKLVSEGDDVPAN"
FT   CDS             890651..891319
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02721"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH2"
FT                   /protein_id="CBE02721.1"
FT                   /translation="MIKIGGNTMSNYRTLHEFGTDEITIEKSVFIGYAKPIKSEEEALE
FT                   FINEIKKKHKDATHNVWAYTVGKNMNIQRYSDDGEPQGTAGIPTLEVIKKEDLRDVVVV
FT                   VTRYFGGTKLGAGGLVRAYTKGAKLGLEAGKIIYKVMYQEVKVKIDYTQLGKVQNELMN
FT                   LGYFIKDTVYEDNVEIVVYSRLEDVEKLSEKMIDITNGTGKIILGEEFYLSEQNGEILI
FT                   "
FT   CDS             complement(891405..891782)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0723"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02723"
FT                   /db_xref="GOA:C9YJH3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH3"
FT                   /protein_id="CBE02723.1"
FT                   /translation="MLFALIGFFAGIIGGMGMGGGTILIPALVLLAGIDTKIAQSVNLL
FT                   SSIPMTLIALAIHIKNKNVIFKLVIPIAVFGVLGAVFGSLLANYLSSDILKKIFGIFLL
FT                   LVGLFEVKKGFCAKSDKKPLN"
FT   CDS             complement(891782..892168)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0724"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02725"
FT                   /db_xref="GOA:C9YJH4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH4"
FT                   /protein_id="CBE02725.1"
FT                   /translation="MKKTDDLKKKYFDFNLKNTIIGVFTGFINGVFGSGGGTLLVPILN
FT                   DIVKVEEHKSHATALSIIIFLTTASSVLYVSKGTYDVNLTIKVAVGSILGGIIGAKLLN
FT                   KVTGKFLRISFGIIMIIAALRMVF"
FT   CDS             892347..893102
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="CDR20291_0725"
FT                   /product="NH3-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02727"
FT                   /db_xref="GOA:C9YJH5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH5"
FT                   /protein_id="CBE02727.1"
FT                   /translation="MSNIKIQIDKTVEWLINKVNEANAKGLIVGVSGGIDSAVVANLIK
FT                   KAFPENSMGVIMSIKSNPQDREDALKVIEGCDIEYLDLDLIEPQSAILDMVVGNLKDKH
FT                   LYRAEYLKMTDANLRARVRMSTIYTIANNLGYLVVGTDNAAEIHTGYFTKFGDGGVDIL
FT                   PIANLTKGEVYEWAKELGVHEDLINKAPSAGLWEGQTDEDEMGTTYNMIDAVLEGRLDE
FT                   VPKRDQEIIERLHRLSEHKRKTPAQPPKF"
FT   CDS             893185..893904
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02729"
FT                   /db_xref="GOA:C9YJH6"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH6"
FT                   /protein_id="CBE02729.1"
FT                   /translation="MGRIGNIINRKGKQDAQRAKIFTKHARAIAVAAKEGGADPEYNAA
FT                   LKTAIEKAKADNMPNDNIDRAIAKGAGAGAGEDYETIVYEGYGPGGVAVIVETLTDNKN
FT                   RTAGNVRYYFDKNGGNLGTSGCVSFMFDKKGQILVGLGDGVSEEELMDVALEAGAEDFI
FT                   TEEDGYEIITTPEDFSSVRDELKAKGYEFISADVKMIPQTTTVLTEESHLKMMNKLVDM
FT                   LEEDDDVQDIYHNWEVE"
FT   CDS             complement(894072..895076)
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0727"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02730"
FT                   /db_xref="GOA:C9YJH7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH7"
FT                   /protein_id="CBE02730.1"
FT                   /translation="MATIKDIAKDCGLSSATVSYVLSGKGNERRIPLHTQELILNSADK
FT                   LGYKRSTPIKHNNIKIAFYWQDEGFELASTNILQAINHIISLEHLNINIIIRPYKVGHL
FT                   CDDEYFFANNYYDGIVLTGINADDIEYLVKNKPKIPVVVVNREIPGFSSVSIDNEETGR
FT                   IAALHAIQNGKNDIAVVFNPTSFTCMTLRGKSFLKTCKEHGIHLSDSIYYCSNKIDSGY
FT                   DIAQKMLAKNSLKKVIFCNHDVVALGMMNAFHESGIVIGEDIQIFAASNGPSRLMARSI
FT                   PPLTVIDLKMEETAERSLRMIIDTVTGRINGIQQQVIYPSIIYRQSSPAQNLL"
FT   CDS             895342..896238
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0728"
FT                   /product="putative hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0728"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02732"
FT                   /db_xref="GOA:C9YJH8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH8"
FT                   /protein_id="CBE02732.1"
FT                   /translation="MSKVNIFEVGPRDGFQNLKEFLETDKKLKIIDGLIASGIKQLEIS
FT                   SFVSPKAIPQMKDAKEVATYCVEKYPDVKLYALVPNLYGAKVAWECGIRDISYVISLSE
FT                   THNKKNINRTHEESIDELKKIMNTYPDMNICIGMATVFGCPFEGLPKIEDAIRFAKRLW
FT                   ENGIREINLADTIGIADPKQVRETISALVEALPECRWQVHIHDTRNMGMVNTLVAIESG
FT                   ITTVQSTLGGLGGCPFAPGASGNTATEDLVYMLERMGYDTGVDFVKLLELSKYQKSFVN
FT                   GVYSGHHVNIKSDSCNC"
FT   CDS             896283..897638
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0729"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0729"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02734"
FT                   /db_xref="GOA:C9YJH9"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJH9"
FT                   /protein_id="CBE02734.1"
FT                   /translation="MLIGKIDLLIKKINYKIHYLIKQIKKLRGISMDIIALLLFLGVII
FT                   IAFVRKNNAGILALAIGVIAVRIFGMDDKELYGAISNSMFTTLVGITLLFAIVNSTGAL
FT                   KLVAEKIVAASGKRVWLIPIAVFIAGFVVAGVGPGAIPALAIIPAMAVPVAITVGYNPV
FT                   MLALIGECGLMAGRMTPITPEGQIITTVAEGVGIENVMPTILACQTLSTIVFSIVLFII
FT                   FKGYKLKKPINVIDSKQIEKFNIKQIISLISIVVMIAFIIIFDMNVGLAAFAVSAVLIF
FT                   FNIADEGECIKSIPWSTIVMVLGVGAMMTIVDAAGGIDLMSNALSSLMNSKTATPIMSI
FT                   SAGLMSMVSSALAVVYPTMMPMCVDIAKAVGGVDPLALIAAVGVGGSLAGVSPLSTGGA
FT                   LILAAMGSSKKDFNKEEQNKVFVQLFIMSAVGLLVIAVVSILSFNAITHLMN"
FT   CDS             897714..898907
FT                   /transl_table=11
FT                   /gene="act"
FT                   /locus_tag="CDR20291_0730"
FT                   /product="putative beta-alanine CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02736"
FT                   /db_xref="GOA:C9YJI0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJI0"
FT                   /protein_id="CBE02736.1"
FT                   /translation="MKKGALSNIKVLDLTRVLAGPYCTMMLADFGADVIKIEMPRKGDD
FT                   TRGFGPFVNGESLYYANINRNKKGITLNLKSEEGKNIFLEMVKHADVVVENYRPGVMEK
FT                   LGLGYDELAKVNNQIIYGAVSGFGCYGPYSERPGYDIIAQAMGGLMSITGQEGGEPTRV
FT                   GNAMGDVLGGMNLTIGILTALNARKIIGKGQRVDVSLVDSVVSSLETGIQRYFDSGQPE
FT                   LMGNRYASAYPYDSFKASDGSFVIGCGNDKLFEKLCKKVLFREDLLIDERFKTNLKRCE
FT                   HYKALKPEIEKWSVKHTIKEAVDLISEAGVPAAPIYNLDCVTTDEHIAKAREMIVDISH
FT                   PIIGNMKVNGNPVKLMTTKAKIDMPAPSLGESNEEIYNGWLGFDSDKIKDLKENGVI"
FT   CDS             899515..900330
FT                   /transl_table=11
FT                   /gene="crt1"
FT                   /locus_tag="CDR20291_0731"
FT                   /product="3-hydroxybutyryl-CoA dehydratase (crotonase)"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02737"
FT                   /db_xref="GOA:C9YJI1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJI1"
FT                   /protein_id="CBE02737.1"
FT                   /translation="MYNGGNMMESVMENLNNLKVEVKDKVCVITINRPKALNALNSDTL
FT                   RELSQVIDVVSENEAILGVIITGEGKVFVAGADIRQMQNYKSEEGRKYAGYAQGIFDKI
FT                   EALEKTVIAAVNGYALGGGCELAMSCDIRIASEKAIFGQPEVNLGVIPCFGGTQRLSRL
FT                   VGTGIAKELIFTGRQVNAEEAKSIGLINKVVPSDLLLEESMKMMNQIVEKAPIAIRYAK
FT                   VVINKGIDMDLKNALELEKDIAGLTFATRDKQEGMNAFIEKRKPVFENK"
FT   CDS             900424..901764
FT                   /transl_table=11
FT                   /locus_tag="CDR20291_0732"
FT                   /product="probable permease"
FT                   /db_xref="EnsemblGenomes-Gn:CDR20291_0732"
FT                   /db_xref="EnsemblGenomes-Tr:CBE02739"
FT                   /db_xref="GOA:C9YJI2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:C9YJI2"
FT                   /protein_id="CBE02739.1"
FT                   /translation="MNTGVIISLVGIIIALSLLVVMVMKGINIFIIAIVCSSLVAITGS
FT                   LNVYDALKVDYMTGFVGFLQANFFIFLTGTLMGKIMEITGGAKSIAKMIVRWIGKDKAL
FT                   LSIPIACGILAYGGVSVFVVSFAVFPIALEIFKEADLPRRFIPAALTFGCSTFAMVAPG
FT                   APQIQNIVPASTLGTDIMAGAVNGFISCAVMFIVGSTILYKMVSKEKANGGHFIAHESD
FT                   IFDEAEATNSKRENGPNGVIALIPLIVSILIINVKVNGKAIVPIEVGVFIGALLVYLLL
FT                   NKYQDNTKIVGHVGDACKTTVVAICNTCAVVAFGSVVKSAVGFDFIVNAMTN