Dbfetch

ID   FN538998; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FN538998;
XX
DT   15-AUG-2009 (Rel. 101, Created)
DT   15-AUG-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*12new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (14-AUG-2009) to the INSDC.
RL   McWhinnie A.J., Research Institute, Anthony Nolan Trust, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.J., Wallis-Jones S., Mepani K., Little A.M.;
RT   "A new HLA-C allele Cw*12XX differing from HLA-Cw*12030101 with a
RT   nucleotide change T to C at position 538 resulting in a coding change from
RT   Tryptophan to Arginine at residue 156";
RL   Unpublished.
XX
DR   MD5; 88428f1c5568e6281aa4617923e7bdeb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /clone="JATH473491AN"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*12:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6F5"
FT                   /protein_id="CBA18267.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12new"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*12new"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 169 A; 254 C; 288 G; 111 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac tgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg tgcagcacga ggggctgcca gagcccctca ccctgagatg      1020
     gg                                                                     1022
//