spacer

EBI Dbfetch

ID   FN433880; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN433880;
XX
DT   05-FEB-2010 (Rel. 103, Created)
DT   05-FEB-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*new
DE   allele, isolate 42595
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Tower R. Franklin -
RL   Molecular Biology - Level 0 N - Avenue Hippocrate, 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "New HLA DRB1 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; 6eb00c38e9ea1091bfa6afbfb6802b57.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="42595"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D3GN37"
FT                   /db_xref="IMGT/HLA:DRB1*08:39"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3GN37"
FT                   /protein_id="CBA13034.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGENFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagaa cttcacggtg cagcggcgag                                        270
//


spacer
spacer