Dbfetch

ID   FN433879; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN433879;
XX
DT   06-NOV-2009 (Rel. 102, Created)
DT   17-SEP-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*04new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (04-AUG-2009) to the INSDC.
RL   Poli F., Medicina Rigenerativa, Ospedale Maggiore Policlinico di Milano,
RL   Via Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1744-313X.2011.01048.x.
RX   PUBMED; 22017792.
RA   Longhi E., Frison S., Mantovani M., Carella G., Malagoli A., Poli F.;
RT   "Description of the new allele HLA-DQB1*04:03:02";
RL   Int. J. Immunogenet. 39(1):77-78(2012).
XX
DR   MD5; b48f990993cf0e8a4ff39212c62011e9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04new"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D0R7H5"
FT                   /db_xref="IMGT/HLA:DQB1*04:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0R7H5"
FT                   /protein_id="CBA13033.1"
FT                   /translation="DFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 69 C; 94 G; 49 T; 0 other;
     aggatttcgt gttccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc ggcttgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg tggacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//