spacer

EBI Dbfetch

ID   FN433086; SV 1; linear; genomic DNA; STD; PRO; 919 BP.
XX
AC   FN433086;
XX
DT   22-JUL-2010 (Rel. 105, Created)
DT   22-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Rhizobium gallicum otsA gene for Trehalose-6-phosphate synthase, isolate
DE   8a3
XX
KW   .
XX
OS   Rhizobium gallicum
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RP   1-919
RA   Vargas C.;
RT   ;
RL   Submitted (27-JUL-2009) to the INSDC.
RL   University of Seville, Microbiology and Parasitology, C/Prof. Garcia
RL   Gonzalez 2, Seville, 41012, SPAIN.
XX
RN   [2]
RA   Fernandez-Aunin C., Ben-Hamouda T., Iglesias-Guerra F., Argandoa M.,
RA   Reina-Bueno M., Nieto J.J., Aouani M.E., Vargas C.;
RT   "Biosynthesis of compatible solutes in rhizobial strains isolated from
RT   Phaseolus vulgaris nodules in Tunisian fields";
RL   BMC Microbiol. 10(1):192-192(2010).
XX
DR   MD5; 8f2f8bcbfea60c100be653a4cdcb25b1.
DR   EuropePMC; PMC2918589; 20633304.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..919
FT                   /organism="Rhizobium gallicum"
FT                   /isolate="8a3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:56730"
FT   CDS             <1..>919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /product="Trehalose-6-phosphate synthase"
FT                   /db_xref="GOA:E1UHW8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:E1UHW8"
FT                   /protein_id="CBA11538.1"
FT                   /translation="MEQGNITXALTDLTDTDVEEYYHGFANRVLWPICHYRLDLAEYGR
FT                   KEMAGYFRVNRFFAHRLAPLIEPDDLIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWP
FT                   PADVLFTMPVHEQIMRGLSHYDVVGFQTDHDLENFAGCLRREGIGDELGEGRYSSHGRT
FT                   FKGGAYAISIETAAFAEFAQRAATNSMVKKARLSIEGRSLIIGVDRLDYSKGITQRIDA
FT                   FERFILANPAQQGRVTYLQITPKSRSEVPEYEAMQRTVAEQAGRVNGALSAVDWVPIRY
FT                   INRSVGRHILAGLYRLGKVGLGRRC"
XX
SQ   Sequence 919 BP; 192 A; 298 C; 252 G; 176 T; 1 other;
     atggagcaag gcaacatcac ctntgcactg acggatctga ccgatacaga tgtcgaagaa        60
     tactatcacg gctttgccaa ccgcgttctc tggccgatct gccactaccg tctggatctc       120
     gcggaatacg gccgcaagga gatggccggc tatttccgcg tcaaccgttt tttcgcccat       180
     cggctggcac ccctgatcga acccgatgac ctcatctggg tgcacgacta ccacctgatc       240
     ccgctcgccg cggaactgcg tcaaatgggc ctgaagaacc gcatcggctt cttcctccat       300
     attccatggc cgcctgcgga cgtgctcttc acaatgccgg ttcacgagca gatcatgcgc       360
     ggcctctcgc actacgatgt tgtcggtttt cagacggatc acgaccttga gaatttcgcc       420
     ggctgtctca gacgtgaagg catcggcgac gaactcggcg aaggccgcta cagctcccac       480
     ggacggactt tcaagggcgg cgcctatgcg atcagcatcg agactgcagc ctttgccgaa       540
     ttcgcccaaa gggccgcgac caacagcatg gtcaaaaaag cgcgcctaag catcgaaggc       600
     cgcagcctga tcatcggcgt cgaccgccta gattattcca agggaatcac gcagcgcatc       660
     gacgctttcg agcgcttcat cctggccaac ccggcacagc aagggcgtgt cacctatctg       720
     cagatcactc cgaagtcccg ctccgaagtg cctgagtacg aagccatgca acgcaccgtg       780
     gccgagcaag ccggcagggt gaatggcgct cttagcgccg tcgattgggt gccgatacgc       840
     tatatcaacc gctccgtggg acgccacatt ctcgcggggc tctaccggct cggcaaagtc       900
     ggcttgggac gccgctgcg                                                    919
//


spacer
spacer