spacer

EBI Dbfetch

ID   FN433085; SV 1; linear; genomic DNA; STD; PRO; 927 BP.
XX
AC   FN433085;
XX
DT   22-JUL-2010 (Rel. 105, Created)
DT   22-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Rhizobium leguminosarum bv. phaseoli otsA gene for Trehalose-6-phosphate
DE   synthase, isolate 31c3
XX
KW   .
XX
OS   Rhizobium leguminosarum bv. phaseoli
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Rhizobium.
XX
RN   [1]
RP   1-927
RA   Vargas C.;
RT   ;
RL   Submitted (27-JUL-2009) to the INSDC.
RL   University of Seville, Microbiology and Parasitology, C/Prof. Garcia
RL   Gonzalez 2, Seville, 41012, SPAIN.
XX
RN   [2]
RA   Fernandez-Aunin C., Ben-Hamouda T., Iglesias-Guerra F., Argandoa M.,
RA   Reina-Bueno M., Nieto J.J., Aouani M.E., Vargas C.;
RT   "Biosynthesis of compatible solutes in rhizobial strains isolated from
RT   Phaseolus vulgaris nodules in Tunisian fields";
RL   BMC Microbiol. 10(1):192-192(2010).
XX
DR   MD5; 6a8a7d2982cf52815ff86bd01c417edc.
DR   EuropePMC; PMC2918589; 20633304.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Rhizobium leguminosarum bv. phaseoli"
FT                   /isolate="31c3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:385"
FT   CDS             <1..>927
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /product="Trehalose-6-phosphate synthase"
FT                   /db_xref="GOA:E1UHW7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:E1UHW7"
FT                   /protein_id="CBA11537.1"
FT                   /translation="QKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFLAHRLAPMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGDGLFDSHGRIF
FT                   KAGAYPIGIETAGFAEFAERAANNIMVQKTRRSIEGRDMIIGGRPPRLFEGHHSAAGSV
FT                   RTLPHQQSGLPEQGHLSAGHAEVAIGSSRIRAYAEXXRRTGRPRERCHRNGRLGADPLC
FT                   QPIDQPQRACRPLPAGDDQAGHAVRDE"
XX
SQ   Sequence 927 BP; 199 A; 281 C; 265 G; 180 T; 2 other;
     gcagaaaggc aacatcacct atgcgctgac cgatctcacc gacaccgacg tcgaggagta        60
     ttatcgcggc ttcgcaaacc gcgttctctg gccgatctgc cattatcgac tggacctcgc       120
     cgaatatggc cgaaaggaaa tggccggcta tttccgcgtc aaccgcttct tagctcatcg       180
     gttggcgccg atgatcgagc ccgatgacat catctgggtt catgattacc acctcattcc       240
     gctggcggcc gaactgcgcc aaatggggct gaaaaaccgg atcggcttct tcctgcatat       300
     tccctggccg ccggccgaca ttctggtcac gatgcccgtc cacgaggaaa tcatgcgcgg       360
     gctttcgcat tacgatctcg tcggcttcca gaccgactac gacctccaga actttgccgg       420
     gtatctgcgc cgggagggaa ttggcgacga cctcggagat ggactgttcg attcccatgg       480
     gcggatattc aaggccggcg cctatccgat cgggatcgaa accgctggtt tcgccgagtt       540
     tgccgagaga gccgcaaaca atatcatggt gcagaagacc cggcgcagca ttgaaggccg       600
     ggacatgatc atcgggggtc gaccgcctcg attattcgaa gggcatcatt cagcggctgg       660
     aagcgttcga acgcttcctc accagcaatc cgggctacca gaacaaggtc acctatctgc       720
     aggtcacgcc gaagtcgcga tcggaagttc ccgaatacga gcatatgcag aagancntcg       780
     ccgaacaggc aggccgcgtg aacggtgcca tcggaacggt cgactgggtg ccgatccgct       840
     atgtcaaccg atcgatcagc cgcaacgtgc ttgccggcct ctaccggctg gcgacgatca       900
     ggctggtcac gccgtgcgcg acgaatg                                           927
//


spacer
spacer