Dbfetch

ID   FN430834; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FN430834;
XX
DT   20-JUL-2009 (Rel. 101, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, allele HLA-Cw*02,
DE   exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Dubois V.;
RT   ;
RL   Submitted (20-JUL-2009) to the INSDC.
RL   Dubois V., Histocompatibility, EFS Rhone Alpes, 1 et 3 rue du Vercors,
RL   69007 Lyon, FRANCE.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01699.x.
RX   PUBMED; 21623732.
RA   Nguyen T.K., Giannoli C., Favre-Victoire I., Dubois V.;
RT   "Sequencing-based typing identifies three new HLA alleles: C*02:29, C*06:29
RT   and DQB1*03:24";
RL   Tissue Antigens 78(4):290-291(2011).
XX
DR   MD5; 17739798e2327f11d0b966cd64d13d0b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: Leu C15, fwd_seq:
FT                   tggcgccccgaaccctcc, rev_name: P3' intron 4 Cw, rev_seq:
FT                   cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*02:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:C7C5G9"
FT                   /protein_id="CAZ91489.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQXXXHPKTHVTHHPVSDHEATLRCWALGFYPTEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHERLPEPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02"
FT                   /number=3
FT   gap             641..740
FT                   /estimated_length=unknown
FT   exon            747..>1022
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 177 A; 252 C; 283 G; 110 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acagcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn gcgcggaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctacccta cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg tgcagcacga gaggctgccg gagcccctca ccctgagatg      1020
     gg                                                                     1022
//