spacer

EBI Dbfetch

ID   FN430611; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FN430611;
XX
DT   17-JUL-2009 (Rel. 101, Created)
DT   17-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*04,
DE   isolate 328333, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (15-JUL-2009) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Harrison K., Mastromarino S.A., Ohashi M., Alosco S., Yu N.;
RT   "New HLA Class alleles identified in donors of NMDP registry";
RL   Unpublished.
XX
DR   MD5; 982a3031df79fec7f3287099bb56249e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="328333"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: C4F, fwd_seq: gtcgggcgggtctcagcc,
FT                   rev_name: CampR, rev_seq: ggagatggggaaggctccccact"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:C7C4Z6"
FT                   /db_xref="IMGT/HLA:C*04:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C7C4Z6"
FT                   /protein_id="CAZ86763.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDWETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 164 C; 200 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     actgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer