spacer

EBI Dbfetch

ID   FN430425; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FN430425;
XX
DT   14-JUL-2009 (Rel. 101, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB5 gene for MHC class I antigen, HLA-DRB5*01
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (14-JUL-2009) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Blood Transfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "New sequences found during routine HLA typing";
RL   Unpublished.
XX
DR   MD5; b596b5a63302a42ff515f819dddbb9d0.
DR   Ensembl-Gn; ENSG00000198502; homo_sapiens.
DR   Ensembl-Tr; ENST00000374975; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*01"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q30154"
FT                   /db_xref="HGNC:HGNC:4953"
FT                   /db_xref="IMGT/HLA:DRB5*01:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30154"
FT                   /protein_id="CAZ86696.1"
FT                   /translation="RFLQQDKYECHFFNGTERVRFLHRDIYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*01"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*01"
FT                   /number=3
XX
SQ   Sequence 652 BP; 130 A; 137 C; 180 G; 105 T; 100 other;
     cacgtttctt gcagcaggat aagtatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgca cagagacatc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ttgagcctaa ggtgactgtg tatcctgcaa ggacccagac cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaaca gccaggaaga gaaggctggg gtggtgtcca caggcctgat tcagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcgaagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgacg agccctctca cagtggaatg ga               652
//


spacer
spacer