spacer

EBI Dbfetch

ID   FN424162; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN424162;
XX
DT   30-JUN-2009 (Rel. 101, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II antigen, allele
DE   HLA-DRB3*01, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Garritsen H.;
RT   ;
RL   Submitted (26-JUN-2009) to the INSDC.
RL   IKTM, Staedtisches Klinikum Braunschweig gGmbH, Celler str. 38, 38114,
RL   Braunschweig, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01412.x.
RX   PUBMED; 20030787.
RA   Garritsen H.S.P., Fae I., Legath N., Hannig H., Fischer G.F.;
RT   "Identification of a novel HLA-DRB3*01 variant, HLA-DRB3*0114, containing a
RT   DRB1 sequence motif by micro-temperature gradient gel electrophoresis
RT   confirmed by sequence-based typing";
RL   Tissue Antigens 75(2):185-186(2010).
XX
DR   MD5; 137c758176ee597d528d031a8e35915b.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*01:14"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="CAZ66766.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 66 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer