Dbfetch

ID   FN421416; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN421416;
XX
DT   23-JUN-2009 (Rel. 101, Created)
DT   23-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*14new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Todorova K.;
RT   ;
RL   Submitted (14-JUN-2009) to the INSDC.
RL   Charite Campus Virchow, Augustenburger Platz 1, 13353 Berlin, Germany,
RL   GERMANY.
XX
RN   [2]
RA   Todorova K., Galicki L., Lassahn A., Schonemann C., Salama A.;
RT   "A novel HLA-DRB1*14 with amino acid substitution by HLA-typing for kidney
RT   transplantation";
RL   Unpublished.
XX
DR   MD5; 5862dbd25b0df4a5c35b4671602cc71c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Berlin, Charite Virchow Klinikum,
FT                   Transfusionsmedizin"
FT                   /isolation_source="peripheral blood"
FT                   /sex="male"
FT                   /note="kidney transplant retyping"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C6H0J8"
FT                   /db_xref="IMGT/HLA:DRB1*14:99"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C6H0J8"
FT                   /protein_id="CAZ65677.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDTYCRHNYGAVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14new"
XX
SQ   Sequence 270 BP; 54 A; 66 C; 100 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//