Dbfetch

ID   FN395287; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN395287;
XX
DT   28-MAY-2009 (Rel. 100, Created)
DT   28-MAY-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*01new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Schuett S.;
RT   ;
RL   Submitted (26-MAY-2009) to the INSDC.
RL   Institut fuer Medizinische Diagnostik, HLA-Labor, Nicolaistrasse 22,
RL   Berlin, 12247, GERMANY.
XX
RN   [2]
RA   Schuett S., Geflitter A., Doebis C.;
RT   "Sequenced-based typing of a novel HLA-DRB1*01 allele in a caucasian
RT   woman";
RL   Unpublished.
XX
DR   MD5; 6d1cd585b2fee04ede5cb3a257e2e84d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C4RA90"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C4RA90"
FT                   /protein_id="CAZ16858.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 98 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtac        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//