Dbfetch

ID   FN393829; SV 1; linear; genomic DNA; STD; HUM; 1056 BP.
XX
AC   FN393829;
XX
DT   15-MAY-2009 (Rel. 100, Created)
DT   15-MAY-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1056
RA   Witter K.;
RT   ;
RL   Submitted (13-MAY-2009) to the INSDC.
RL   Laboratory of Immunogenetics, University of Munich, Max-Lebsche-Platz 32,
RL   81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; d79ead538a64ea77662dd02a84ec2c37.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1056
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..42
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=1
FT   CDS             join(<43..306,630..>911)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*123:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAY85528.1"
FT                   /translation="NYLFQGRQEGYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            43..306
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   intron          307..629
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   gap             332..431
FT                   /estimated_length=unknown
FT   exon            630..911
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
FT   intron          912..>1056
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
XX
SQ   Sequence 1056 BP; 242 A; 250 C; 279 G; 185 T; 100 other;
     tgagagtggc cgcctccgct catgtccgcc ccctccccgc agagaattac cttttccagg        60
     gacggcagga aggctacgcg tttaatggga cacagcgctt cctggagaga tacatctaca       120
     accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg gtgacggagc       180
     tggggcggcc tgatgaggag tactggaaca gccagaagga catcctggag gaggagcggg       240
     cagtgccgga caggatgtgc agacacaact acgagctggg cgggcccatg accctgcagc       300
     gccgaggtga gtgagggctt tgggccggcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nttgcgccac tgcattccag acttggcaac agagtgacac tccatctcaa       480
     caaaaagaaa gaatgaaaga aagaaagagc gagattatgt ctcaaaaaaa aggaaggaag       540
     gaaggaagga aggaaggaag gaaggaagga aggaaggaaa gaaggacaat ctcaaattct       600
     atttcattat ttttcttcca cgctcctagt ccagcctagg gtgaatgttt ccccctccaa       660
     gaaggggccc ttgcagcacc acaacctgct tgtctgccac gtgacggatt tctacccagg       720
     cagcattcaa gtccgatggt tcctgaatgg acaggaggaa acagctgggg tcgtgtccac       780
     caacctgatc cgtaatggag actggacctt ccagatcctg gtgatgctgg aaatgacccc       840
     ccagcaggga gatgtctaca cctgccaagt ggagcacacc agcctggata gtcctgtcac       900
     cgtggagtgg agtgagtctc tgatgaccct ctagacccca cctctgaaga gcaggggact       960
     ctctggctct ggggtccact catcttatct tctgcatcta taccctgggg ccatgtccaa      1020
     accccatctt tcttctatac cagctcctga gcatag                                1056
//