spacer

EBI Dbfetch

ID   FN393087; SV 1; linear; genomic DNA; STD; FUN; 8358 BP.
XX
AC   FN393087;
XX
PR   Project:PRJEA37863;
XX
DT   23-SEP-2009 (Rel. 102, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae EC1118 chromosome XV, EC1118_1O30 genomic
DE   scaffold, whole genome shotgun sequence
XX
KW   .
XX
OS   Saccharomyces cerevisiae EC1118
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-8358
RA   Wincker P.;
RT   ;
RL   Submitted (28-APR-2009) to the INSDC.
RL   Wincker P., Genoscope - Centre National de Sequencage : BP 191 91006 EVRY
RL   cedex -FRANCE (E-mail : seqref@genoscope.cns.fr - Web :
RL   www.genoscope.cns.fr).
XX
RN   [2]
RX   DOI; 10.1073/pnas.0904673106.
RA   Novo M., Bigey F., Beyne E., Galeote V., Gavory F., Mallet S., Cambot B.,
RA   Legras J.L., Wincker P., Casaregola S., Dequin S.;
RT   "Eukaryote-to-eukaryote gene transfer events revealed by the genome
RT   sequence of the wine yeast Saccharomyces cerevisiae EC1118";
RL   Proc. Natl. Acad. Sci. U.S.A. 0:0-0(2009).
XX
DR   MD5; c33fab567598df1b681f4fa30cae425f.
DR   BioSample; SAMEA2272624.
DR   EuropePMC; PMC2740733; 19805302.
DR   EuropePMC; PMC2876123; 20412590.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8358
FT                   /organism="Saccharomyces cerevisiae EC1118"
FT                   /chromosome="15"
FT                   /strain="Lalvin EC1118"
FT                   /mol_type="genomic DNA"
FT                   /clone="scaffold EC1118_1O30"
FT                   /db_xref="taxon:643680"
FT   gene            complement(<193..>3135)
FT                   /locus_tag="EC1118_1O30_0001g"
FT                   /old_locus_tag="EC1118_1O30.gene1_val"
FT                   /standard_name="HPF1"
FT   CDS             complement(193..3135)
FT                   /locus_tag="EC1118_1O30_0001g"
FT                   /old_locus_tag="EC1118_1O30.gene1_val"
FT                   /product="Hpf1p"
FT                   /note="Similar to YOL155C HPF1 Haze-protective mannoprotein
FT                   that reduces the particle size of aggregated proteins in
FT                   white wines"
FT                   /db_xref="UniProtKB/TrEMBL:C8ZGP9"
FT                   /protein_id="CAY82566.1"
FT                   /translation="MLNRFNKFQAALALALYSQSVLGQYYPNSTTIPSNSSSSSFSSTS
FT                   SSSFSISSSITQSTSSTPDVSSSLTQLTSSSDVSSSIASSSSPGSGVSSSVTQSSSSGS
FT                   SPSGTGSTATTPSGTTPSGTGSTATTPSGTTPSGTGSTATTPSGTTPSGTGSTATTPSG
FT                   TGSTATTPSGTGSTTTSPSGSGPSESGSSASITQSVSSAPSLSSSIPQSTSSGSTVSGS
FT                   VTGSLSSITSSASSASATASNSLSSSDGTIYLPSTTISGDLTLTGSVIATEAVEIAAGG
FT                   KLTLLDGDKYVFSADLIVHGDLSVEKSKPTYPGTEFDITGENFDVSGTFNAEEPAASSA
FT                   STYSFTPGSFINSGGISLSLSASPKGEVTFSPYSNSGTFTLSNSNINGGSVSGLQRRAE
FT                   SAGSVNNGEINLDNGSTYVIVEPVSGSGTINIISGNLYLHHPDTFTGQTVVFKGEGVLA
FT                   VDPTESNSTPIPVIGYTGKNQIAITADVTSLSYESTTGVLTATQGNSQFSFAIGTGYSS
FT                   SGFNVSEGTFAGANAYYLNYGGAIASSATSSSTPATSGLFSSTSVTGSTLVTSSRTAIS
FT                   GSATSVSGSSLKASSGTSVTTESNSVTVPVTTTSSAISVYTTTLTYVSATSTVLVSCSE
FT                   TTDSNGNVHTITTSIPCPSTTATITTCDETGCHVTTSSGSIPTETVSSKSYTTTTVTYC
FT                   DNNGCNTKTVTSECPEETSATTAPPRTYTTTTLTHCDDNGCNTKTVTSEAPEATTTTVS
FT                   PKTYTTATVTQCDKNGCNTKTVSSEVAKQTSEIGASPKTYTTATVTQCDGNGCKTKTVT
FT                   SEAPKETSSEISSSKPCTTATVTNCDENGCKVSVVTSEASNASPIATFASSKPYTTSTV
FT                   IQCDKNGCNTKTITSQVLEATSVISAPSAAPKSYVAGNSETVKATSLTTAISGASSAIS
FT                   IVPKSGSSISLTTGHKTSTGIITQSEAIAAGLNTHTFNALLGLFVLAFFN"
FT   gene            <6530..>7219
FT                   /locus_tag="EC1118_1O30_0012g"
FT                   /old_locus_tag="EC1118_1O30.gene2_val"
FT   CDS             6530..7219
FT                   /locus_tag="EC1118_1O30_0012g"
FT                   /old_locus_tag="EC1118_1O30.gene2_val"
FT                   /product="EC1118_1O30_0012p"
FT                   /note="Similar to Saccharomyces cerevisiae Sigma 1278b MPR1
FT                   Putative N-acetyltransferase"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C8ZGQ0"
FT                   /protein_id="CAY82567.1"
FT                   /translation="MDAESIEWKLTANLRNGPTFFQPLADSIEPLQFKLIGSDTVATAF
FT                   PVFDTKYIPDSLINYLFKLFNLEIESGKTYPQLHSLTKQEFLNYWFHSFAVVVLQTDEK
FT                   FIQDNQDWNSVLLGTFYIKPNYAPRCSHNCNAGFLVNGAHRGQKVGYRLAQVYLNWAPL
FT                   LGYKYSIFNLVFVTNQASWKIWDKLNFQRIGLVPHAGILNGFSEPVDAIIYGKDLTKIE
FT                   PEFLSME"
XX
SQ   Sequence 8358 BP; 2591 A; 1455 C; 1770 G; 2542 T; 0 other;
     tttttttttt ggttgataaa tgagctttgt ttcaggttaa tgcatttatc aaaatcaata        60
     cgttcaaaaa agggtattgc attttaaaaa gttaagctaa aaaatactta aatgtttaca       120
     ctaagcgcat atcaagcgca tgttaaagaa cttattttgt ttcggaggag tacagttgat       180
     tcctcgatta ggttagttaa agaaagcaag aacgaaaaga ccgagcaaag cgttgaatgt       240
     gtgggtattc aaacctgcag caatagcttc ggactgggtg atgataccgg tagaagtttt       300
     atgaccggta gttagagaaa ttgaagagcc agatttaggg actatggaga ttgcactaga       360
     tgccccagaa atggcagtgg tcaatgaggt tgctttaacg gtctcggaat tgccagcaac       420
     gtatgatttt ggagcggcgg aaggtgcgct gataactgaa gtagcttcaa gtacctggga       480
     agtgattgtc ttggtgttac agccattttt atcgcattgt ataacggtgg aggtggtgta       540
     aggtttggaa gatgcaaatg ttgcgattgg agatgcgtta gaagcttcgg aggtaacaac       600
     gctcactttg cacccatttt catcacaatt agtaacagtc gcagttgtgc atggtttaga       660
     agaagagatt tctgatgagg tttctttagg agcttcggaa gtgacagtct tggtcttaca       720
     accattgcca tcacactgag taacagtagc ggtagtatac gtttttggag aagcaccgat       780
     ttctgaagtt tgtttagcaa cttcagagct gactgtttta gtgttacaac catttttatc       840
     gcactgagta acagtagcag tcgtgtacgt ttttggagaa acagtagtgg ttgtggcttc       900
     aggggcctca gaggtgacag tcttagtgtt acagccatta tcgtcacagt gagttagtgt       960
     ggtagtagtg tatgttcttg gaggcgcggt agttgccgag gtttcttcag gacattcaga      1020
     agtgacggtc ttggtgttac atccattgtt gtcgcagtaa gtgacagtgg tagtggtata      1080
     tgacttggaa gagacggttt cagttgggat tgaaccactg gatgtagtaa catgacatcc      1140
     agtttcatcg caagtagtga tagtggcggt agtggatgga catggaatac tcgtggtaat      1200
     ggtgtgaacg ttaccgttac tatctgttgt ttctgaacag gacactagaa ctgtacttgt      1260
     agcagatacg tacgttaatg ttgtagtgta aacggagatg gctgacgaag tggtcgtgac      1320
     tgggacagta actgagttcg attcggttgt aacggaagta ccagacgaag cctttaaact      1380
     cgaaccgcta acagaagtgg ctgaaccaga gatagcggtg cgagatgaag tgactagggt      1440
     agatccggta acagaggtag aagaaaacaa acctgatgtg gcaggtgtgg atgaagatgt      1500
     agcactagaa gcaatagcgc caccgtaatt taggtagtaa gcattggcac ctgcaaaagt      1560
     tccttcagag acgttaaagc cagaactgga gtatccagta ccgatggcaa aagaaaactg      1620
     tgagtttccc tgagtggcag ttaaaacacc agtggtactc tcgtaagaga gagaagtaac      1680
     atccgccgta atggcaattt ggtttttacc agtgtatcca attacaggga taggggtgct      1740
     gttgctttcg gtagggtcaa cggcgagaac accttcaccc ttgaatacaa cagtttgacc      1800
     agtaaaggtg tccggatggt gtaagtacag gttaccagag atgatgttga tcgtaccact      1860
     tccagaaact ggttcgacaa taacataggt actgccattg tcaagattta tttcaccatt      1920
     gttcacagac cctgctgatt cagctctacg ttgtaaacca gaaacagaac caccgttaat      1980
     attagagttt gagagggtga acgtaccaga atttgagtat ggagagaacg taacttcgcc      2040
     ctttggagat gctgacaggc tcaaagaaat gccgccacta tttatgaaag agccaggcgt      2100
     gaaggagtag gtagacgcag aagaagcggc gggctcttcg gcgttgaagg taccagagac      2160
     atcaaaattt tcaccagtaa tgtcgaattc ggtacctggg taagttggct tagacttctc      2220
     tacggacaag tcaccatgga ctatcagatc agctgagaaa acatatttat caccgtcaag      2280
     aagggtcaac ttaccacctg cagcgatttc tacggcctct gttgcaatca cagaacctgt      2340
     aagggtaaga tcaccactga tcgtcgtaga tggcaaataa atagtgccat cgctggaaga      2400
     aagagaattg gaagcggttg cacttgcact agaagctgaa gaggtaatgg aactcaagct      2460
     accggtgaca gaacctgaaa cagtagaacc ggaggaggtt gattggggaa ttgaacttga      2520
     gagactagga gcggatgaga ccgattgtgt gatagaggcg gatgatccag attcagatgg      2580
     accactgccc gatggactag tggttgttga acccgtacca gatggagtag tagctgttga      2640
     acccgtgcca gatggtgtag tagctgtgga accagtacca gatggagtag tgccagatgg      2700
     tgtagtagct gtggaaccgg tgccagatgg tgtagtgcca gatggtgtag tagctgtgga      2760
     accagtacca gatggagtag tgccagacgg agtagtagct gtggaaccag taccagatgg      2820
     actactgcca cttgaactcg attgagtaac agaacttgac actcctgaac caggagagga      2880
     cgatgaagca atagagctcg aaacatccga agatgaggtt aattgagtga gagaactcga      2940
     aacatcgggg gttgatgaag tcgattgagt aatagaacta ctaatagaaa aggaacttga      3000
     tgaggttgat gaaaaagaag atgatgagct gttgcttgga attgtagtgc tatttggata      3060
     gtactgacct agtacacttt gtgaataaag ggctaaagct aaagcagctt gaaacttatt      3120
     aaagcgattg agcatctctt caacacaggc gagatattac cagaaaattg caacgataag      3180
     atactgttgc cgctgttgtt cttaatgaat aaacatttga aatgtaaaaa atagtgagtc      3240
     tagttccagt gtgaagtaaa ctgaagtttt tcctatgctt tttatagttt gtttttttct      3300
     tttgcacagt tctttgagat tttgatgaac agctgcaatg atcaactgtt gacttagttt      3360
     aatcttcgtt tcgtacagga ctttctaaga aaatatatgc aagttccatg cgttccttga      3420
     gcatggaacg ggatgaaatt atgcgcaaaa ggcacgcatc ctgcaaataa cttacctgtg      3480
     atcccctcac tatatgcaaa tactttccaa aagtggtttt gctccatcag ataagagcag      3540
     gcaaagaagt tcgcttcaga taataattat caaggaacgc cacacgaaag aaggggcttt      3600
     attgcaggag cggctaccca attctattta gcagaaatat tatccgcttt gtccaatttg      3660
     ggccaatggt cagctatcgc tactagtaag ggaccattgt gcctgcttta ctaaaagaaa      3720
     tttcttcaaa cccgcagatg aaaaccatca gacctttctc aaggtaccga aaagtcggag      3780
     agttttagcc attaaagcga actaatttca ctgtgttcct gaaatgattt attccgagtg      3840
     tgacgccaac catatccagt tttgttgaga ggtggctcgc catggtcttg tttacaacgc      3900
     acaccgtttc gcgagctcct ttcacaacta ctacaaaagt tcaagatttc ctctttagta      3960
     tatccaggat tcttgccggt ccaaaaaaag ttgtttaaca tacaagataa aggcgtgaaa      4020
     agcactaaat ctaggaagaa ttatacagct cttgctcata ttgagaacta acttgccaat      4080
     gtatatttac aatctttcat gaaattattt gtgttaattt catgccggag aagtatacct      4140
     gtaggaacct gtaggaacct gtagaaagaa gtgtctgagg tacttttgaa ttttctttca      4200
     agtgattgtt ttctttccac catcttttat gataagcttt tgtgaatatg agcgattatg      4260
     catgaaagat ttgatgttaa gcaagcttag cacaaacaag aggtgaaaaa aaggaaaaaa      4320
     aacttcagtt ccgtatttgg aaacaaattt ttacgatcta gtgtctatta acggtcaagg      4380
     aaaatgaagt ttttctaggt agaatacgag agtaagcctg taagtcaaaa ttgtaattct      4440
     ctaatattga actttaaagt atagttacgc atgagctccc tcacagggac atagaatcca      4500
     ctaaagaaga cgtcacctat tcaatccagt gcaccccgtg attagctaga tacgtcaaca      4560
     tagttttttt tttttttgat caaggagaag tacatgcttt ttttaccctt tttttcatga      4620
     aagttttgag ggttaggatc gttgaactta cgctagacat tcggacttcc gaattttcat      4680
     gaaggcggcc cattttcatt ctaattgaat agttctccac cattttctcc aaaacaacca      4740
     atagatttcg aacaaaactt ctgggtcttc gtgtattgtc atctaattca aaaacagagt      4800
     cctcctaacg tgcatttttc ccaaggcttt tttttaaata atagataata ttctccataa      4860
     tgagcagtat tgattttcac tatctagtag tggccatcta attgaacatt gtaatattta      4920
     ttttcgtatt tactcatcgt acacaaataa gttttagata aacttattac ggtgttgaac      4980
     gctctctttc tatagtaatt atgcttgaaa tataacatag tagaatatac aagaatattg      5040
     gtggcgagtt gaattgtgac atcttatagg tttttccagg ttactttttt tttgcattcg      5100
     taaaggtgtt cacaactgga gcacaaattg agagttatct cacctcttcc ctacactaca      5160
     aatgaggtgg aattccctgt tcggcagctt acttcagttt aacaatttct tgaaggtaaa      5220
     atcccccctg agaggacttc ttgagataaa tattattata cccaaattcg tcgacaaaat      5280
     tttctcaact actatttcaa gaggcatatt tctcgttttt tttttccaca gtatctacaa      5340
     gacataatca cgcattaccc tttgatttta atcattatta ctaattgctg ttatcataaa      5400
     gactctctaa caactacgca aaagaaaggc taattacaag cgtccaagca ttaagcacta      5460
     tgtattggta tgcgcaacaa gtgcatatat atttatctgt cttttgctgt tttgtctact      5520
     tccactaaca aagcttacaa agactcttct gcacccctct ttgggggaag ggtattattg      5580
     tgattctgct attcaaatcc acaatctgca acaaaaccgg aggttgcatg aatttctatt      5640
     caaacaagag taatgctata tatcaatatc acgaaatgtc tctgatttac acctttgcaa      5700
     tcctttcaat aaccttattt ctatatcggc gtatactatg caaacataat ctcggcatag      5760
     ccacgcgaaa ggactcgaga aagattgaaa taataattat ccataaagaa ggtgctgcag      5820
     atctaattca aaagaactgc agaaaatata tcgtcgccat aaattatggt atagcgtata      5880
     acagcatttg atatttagtg aaggggcagg aatgtatggg gcgtattttt cagcacgtta      5940
     attttagcga gaaacctctt ttctaattgg aggttttata ggatatgtca atattctata      6000
     atcgattact gcagcctgac gtctgtttca ataatcacac gtacatgttg gcacttttaa      6060
     gccttcgctg tatgaatttt actaatttag aaaaccgacc ttgataatag acgtgttagc      6120
     tgaatccgag ttgatagcag agtaattttt accaaaaaaa tttggaaaca attgcaacgt      6180
     attttaaatc atatgacctt atctggatga aagatagctt tttaggaaaa ccgtggaacc      6240
     aatcgatata agattcgtac ttagcatact gtgcgttaca cagcgactct gatagtactt      6300
     cgaattattc tcgtaaatat ttcttattta tattacatga ggtatttttg ggtgtattct      6360
     tcttttttgg ccttatcatt ccatatcgca ggagaagata gaatacgaca aaatatttca      6420
     agacccgtgt aacaagaaaa agaaaaagat ataatgctcg agaagcttcg aatgctttac      6480
     tcatataacg gattgatata ggtaacacta tatatttctg gaagcagaga tggatgcgga      6540
     atccatcgaa tggaaactaa ctgcaaattt acgtaatgga cctacttttt ttcaaccgtt      6600
     agccgactct attgaaccat tacagttcaa acttatcgga tcggatacag tggcaactgc      6660
     atttcctgta tttgacacca aatatatacc ggactcactc attaactatc tttttaaatt      6720
     gtttaatttg gaaattgaaa gtggcaagac ttatccacaa ttgcacagtt tgacaaaaca      6780
     ggaattctta aattattggt ttcattcatt cgctgtcgtt gttttgcaaa ccgatgagaa      6840
     atttattcaa gataatcaag actggaattc agttctcttg ggcacattct acatcaagcc      6900
     caactatgct ccgcgttgct cgcataattg caatgctggc tttctagtta atggtgccca      6960
     tagaggtcag aaggttggct acaggcttgc ccaggtatac ttgaattggg caccattatt      7020
     gggctataaa tactctatct ttaatcttgt ctttgttacc aaccaagcta gttggaaaat      7080
     atgggacaaa ttaaactttc agagaattgg actggtgcct catgccggaa ttttgaatgg      7140
     tttcagtgag cccgtggatg ccattattta tggtaaagat ttgacaaaaa tagaacccga      7200
     attcctctcc atggaataat catagacact gtgtaatgtt ttcttttctg gtttcttttc      7260
     tctttagtta cacataattt cgaataagta tatatccgtt gttattagac tcttaaaaga      7320
     attttaaact ctgaaacctg tcattttcta attgagacat gtatgcattg aaaagaacga      7380
     ataacgacgc gtcgcttaat gtcataataa tggccacact atctgtgcaa atagaaacgg      7440
     caagaagaca aattttgtac ccatgtaaat gaaattctat taaacaactt agttatcatt      7500
     tgaccaaatg agaaaacata gtaacaatct tgaatttttg ggcttaacgt taacatttat      7560
     gaagtttata ttgtagtggc atgactcttt acatgtttca gaggattggc aaaaaatgag      7620
     atattcacac ggtaaaggta actaatatta gactcatcaa tttaaaatca aacgctaatt      7680
     ttatataaat gttatttgct cttggattaa ggttatagta aattgctgaa ccggttgatg      7740
     cattgcacat atttaaaatg atcgatagct tattttttat atatatttct tgtcgaaggt      7800
     attttcaact tctagcttta atcgattgta ttaaccaaag ttgccaagat ttttgtaatc      7860
     atagaagaac aaagggtttt ttctgtactt tatttttttt tttggccttt gcaagggaaa      7920
     ccaataacaa gtctaagtac gttaagaaaa tataaaaaag ttatatttga gattaatatc      7980
     agtctagttt agatgcaata cttaaagtat agatggggtc acaagatatt tctctttata      8040
     catatatata tatatatata tatatatatg taccatcctc tttccgggcc aactgggata      8100
     tgcgaataaa gcctttttgc cggcgtaaag tttttaggga aaaaagattg gcgccttaaa      8160
     tgcataaaaa cggccatccc ccggaggggg gcaacctaaa agcctttttt cggtttttgg      8220
     gtattaaagc aaagaaccca atttccaatt ggatgggcct ataaaactaa aaaaaataca      8280
     aaattttttc cccaaaacaa aagggttgaa aaaattacct tttctacttt tataaaaaaa      8340
     gggggggttt ttaaacca                                                    8358
//


spacer
spacer