spacer

EBI Dbfetch

ID   FN390946; SV 1; linear; genomic DNA; STD; HUM; 1251 BP.
XX
AC   FN390946;
XX
DT   01-MAY-2009 (Rel. 100, Created)
DT   01-MAY-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*1101new allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1251
RA   Witter K.;
RT   ;
RL   Submitted (27-APR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Zahn R., Volgger A.;
RT   "Confirmation of several HLA-DRB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 3d8f56739ce416d9576ef27ca17ef5da.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1251
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<136..405,830..>1111)
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:C3W973"
FT                   /db_xref="IMGT/HLA:DRB1*11:01:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C3W973"
FT                   /protein_id="CAY46412.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            136..405
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /number=2
FT   intron          406..829
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /number=2
FT   gap             454..553
FT                   /estimated_length=unknown
FT   exon            830..1111
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101new"
FT                   /number=3
XX
SQ   Sequence 1251 BP; 257 A; 300 C; 328 G; 266 T; 100 other;
     ggtggggcgt tgcggcgggg gccggttaag gttcccagtg cccgcacccg gcccagggag        60
     ccccggatgg cggcgtcact gtcagtgtct tctcaggagg ccgcctgtgt gactggatcg       120
     ttcgtgtccc cacagcacgt ttcttggagt actctacgtc tgagtgtcat ttcttcaatg       180
     ggacggagcg ggtgcggttc ctggacagat acttctataa ccaagaggag tacgtgcgct       240
     tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct gatgaggagt       300
     actggaacag ccagaaggac ttcctggaag acaggcgggc cgcggtggac acctactgca       360
     gacacaacta cggggttggt gagagcttca cagtgcagcg gcgaggtgag cgcggcgcgg       420
     ggcggggcct gagtccctgt gagctgggaa tctnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnctctgta ctttcaaaga tttgtaaaca ctttgacaat gcatgacaat       600
     ttcaagctat gaagaaacaa acacaatttt tcacaatatc tctcaaatct aataggtcct       660
     cactatcaag attaagttcc aggctgatga cactgtaagg ccacatggcc agctgtgctg       720
     gaggcctggt caaggtcaga gcctgggttt gcagagaagc agacaaacag ccaaacaagg       780
     agacttactc tgtcttcatg actcattccc tctacctttt ttctcctagt ccatcctaag       840
     gtgactgtgt atccttcaaa gacccagccc ctgcagcacc acaacctcct ggtctgctct       900
     gtgagtggtt tctatccagg cagcattgaa gtcaggtggt tccggaatgg ccaggaagag       960
     aagactgggg tggtgtccac aggcctgatc cacaatggag actggacctt ccagaccctg      1020
     gtgatgctgg aaacagttcc tcggagtgga gaggtttaca cctgccaagt ggagcaccca      1080
     agcgtgacaa gccctctcac agtggaatgg agtgagcagc tttctgactt cataaatttc      1140
     tcacccacca agaaggggac tgtgctcatc cctgagtgtc aggtttctcc tctccgacat      1200
     cctattttca tttgctccat gttctcatct ccatcagcac aggtcactgg g               1251
//


spacer
spacer