Dbfetch

ID   FN356027; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN356027;
XX
DT   14-APR-2009 (Rel. 100, Created)
DT   29-JUN-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen,
DE   HLA-DQB1*0302var allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Todorova K.;
RT   ;
RL   Submitted (11-APR-2009) to the INSDC.
RL   Charite Campus Virchow, Augustenburger Platz 1, 13353 Berlin, Germany,
RL   GERMANY.
XX
RN   [2]
RA   Todorova K., Diederich G., Schoenemann C., Salama A.;
RT   "A novel HLA-DQB1*0302 variant";
RL   Unpublished.
XX
DR   MD5; 0f2428bfcbdd01e40da7bd09a35e4073.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany:Berlin"
FT                   /isolation_source="peripheral blood"
FT                   /collection_date="27-Feb-2009"
FT                   /sex="female"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT                   /bio_material="Charite Berlin:200902857"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302var"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C1LZ07"
FT                   /db_xref="IMGT/HLA:DQB1*03:02:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C1LZ07"
FT                   /protein_id="CAX83213.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302var"
XX
SQ   Sequence 270 BP; 59 A; 73 C; 93 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//