Dbfetch

ID   FN313509; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN313509;
XX
DT   07-JUL-2009 (Rel. 101, Created)
DT   07-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*new
DE   allele, isolate 42856, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gervais T.G.;
RT   ;
RL   Submitted (07-APR-2009) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Tower R. Franklin -
RL   Molecular Biology - Level 0 N - Avenue Hippocrate, 10, Brussels, 1200,
RL   BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "New HLA DRB1 allele identified by sequence-based typing";
RL   Unpublished.
XX
DR   MD5; 1b55d1fd1fc552ebfaa007ae549a64c2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="42856"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C6GZ76"
FT                   /db_xref="IMGT/HLA:DRB1*03:05:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C6GZ76"
FT                   /protein_id="CAX68268.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//