spacer

EBI Dbfetch

ID   FN298397; SV 1; linear; mRNA; STD; INV; 1998 BP.
XX
AC   FN298397;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Isodiametra pulchra pulchra mRNA for elongation factor 1-alpha (efalpha
DE   gene)
XX
KW   .
XX
OS   Isodiametra pulchra pulchra
OC   Eukaryota; Metazoa; Xenacoelomorpha; Acoelomorpha; Acoela; Isodiametridae;
OC   Isodiametra.
XX
RN   [1]
RP   1-1998
RA   De Mulder K.;
RT   ;
RL   Submitted (01-APR-2009) to the INSDC.
RL   De Mulder K., University of Innsbruck, Institute of Zoology,
RL   Technickerstrasse 25, 6020 Innsbruck, AUSTRIA.
XX
RN   [2]
RA   De Mulder K., Pfister D., Kuales G., Willems M., Egger B., Salvenmoser W.,
RA   Thaler M., Gorny A.K., Hrouda M., Borgonie G., Ladurner P.;
RT   "Enigmatic acoels: characterization of the stem cell system of the acoel
RT   isodiametra pulchra";
RL   Unpublished.
XX
DR   MD5; c139395cde87bc8eef48c84acc90f27c.
DR   EuropePMC; PMC2806412; 20017953.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1998
FT                   /organism="Isodiametra pulchra pulchra"
FT                   /sub_species="pulchra"
FT                   /mol_type="mRNA"
FT                   /country="USA:Maine"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:633387"
FT   mRNA            1..1998
FT                   /gene="efalpha"
FT                   /experiment="whole mount cDNA"
FT   5'UTR           <1..72
FT                   /gene="efalpha"
FT   CDS             73..1479
FT                   /gene="efalpha"
FT                   /product="elongation factor 1-alpha"
FT                   /db_xref="GOA:D5G3L7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5G3L7"
FT                   /protein_id="CAX65670.1"
FT                   /translation="MVKELKHVSIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFQTEKYYVTVIDAPGHRDFIKNMIT
FT                   GTSQADCAVLVVPAGKGEFEAGISKEGQTREHALLAFTLGVKQMIVAVNKMDASEPPYS
FT                   QSRYEEICKEISAYLKKVGYNPKTVAMVPISGWVGDNMIEESANMPWFKEWSIERKNAD
FT                   GKEEKVSGKTLFNALDAIVPPSRPTDRPLRLPLQDVYKIGGIGTVPVGRIETGILKPAM
FT                   VVTFAPANLTTECKSVEMHHEQLQEAVPGDNVGFNVKNVSVKDIKRGMVCGDSKNDPPK
FT                   EAKDFTAQVIVLNHPGEIHAGYSPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKMV
FT                   KSGDAAIVTMIPSKPMCVEKFSEYAPLGRFAVRDMKQTVAVGIIKDVTKGESAGKVTKA
FT                   AQKAGAGKKK"
FT   3'UTR           1480..1998
FT                   /gene="efalpha"
XX
SQ   Sequence 1998 BP; 560 A; 444 C; 495 G; 499 T; 0 other;
     gccattacgg ccgggggacg tttgccggcg agagattctc tgttgagaaa acttatttat        60
     ccctgagtga aaatggtgaa ggaactgaag catgtcagta ttgtcgtcat tggccacgtc       120
     gacagtggca agtctactac cactggccat ctcatctaca agtgcggtgg cattgacaag       180
     cgaaccattg aaaagttcga gaaagaagcc gctgagatgg gaaaaggttc cttcaaatac       240
     gcttgggttc tggataagct gaaggctgag cgtgagcgtg gtatcactat tgatatcgct       300
     ctgtggaagt tccaaacaga gaagtactac gtcactgtca tcgatgcgcc tggacatcgt       360
     gatttcatca aaaacatgat cactggtacc tcccaagcgg attgtgcagt gttagttgtg       420
     cctgctggca aaggtgaatt cgaggctggt atctcaaaag aaggacaaac tagagagcat       480
     gccctccttg catttactct cggtgtgaag cagatgattg ttgccgtaaa caagatggat       540
     gcttcagaac cgccttacag tcaatcaaga tacgaggaaa tctgcaaaga aatcagcgcc       600
     tacttgaaga aggtcggata caacccgaag accgttgcta tggtccccat ctctggttgg       660
     gtgggagaca acatgattga ggaatcagcc aacatgccct ggtttaaaga atggagcata       720
     gagcgaaaga atgctgatgg taaagaagag aaagtgtctg gaaagacctt gttcaatgcc       780
     ctcgatgcga ttgtaccgcc tagcagaccc acggatagac ccctcagact tcctctccaa       840
     gacgtctaca agattggtgg cattggaaca gtgccagtcg gcagaattga aactggaatc       900
     ttgaagccag cgatggtggt tacctttgct ccagctaatc tgactactga gtgcaaatca       960
     gttgagatgc atcacgagca gctgcaagaa gctgtgcctg gtgacaacgt tggttttaac      1020
     gtgaagaacg tgtcagtgaa ggatatcaag agaggcatgg tgtgtggcga tagcaagaat      1080
     gatcctccta aggaagcgaa ggatttcact gctcaagtca tcgttcttaa ccaccccggt      1140
     gagatccacg ccggttactc cccagtgctg gattgtcaca ctgctcacat tgcctgcaag      1200
     ttcgctgaac tgaaagagaa gatcgacaga aggtcgggta agaaacttga ggataaccca      1260
     aagatggtca agtcagggga tgctgctatt gttactatga ttccatccaa gcccatgtgt      1320
     gttgagaagt tctctgagta tgctccactt ggccgtttcg ctgttcgtga catgaagcag      1380
     acagtcgctg ttggtatcat caaggacgtt acaaagggcg agtcagctgg caaagtcaca      1440
     aaggcagcac agaaggccgg tgcgggaaag aagaaataaa ttttattgag aattttgaca      1500
     taattgagtc ttctcgctgg tcaaaaaaaa aaaaaaaaca ttcttgctat cgccacacac      1560
     catgcctctc ttgatatcct tcactgacac gttcttcacg ttaaaaccaa cgttgtcacc      1620
     aggcacagct tcttgcagct gctcgtgatg catctcaact gatttgcact cagtagtcag      1680
     attagctgga gcaaaggtaa ccaccatcgc tggcttcaag attccagttt caattctgcc      1740
     gactggcact gttccaatgc caccaatctt gtagacgtct tggagaggaa gtctgagggg      1800
     tctatccgtg ggtctgctag gcggtacaat cgcatcgagg gcattgaaca aggtctttcc      1860
     agacactttc tcttctttac catcagcatt ctttcgctct atgctccatt ctttaaacca      1920
     gggcatgttg gctgtttcaa taaaaaactt tactaacatg aaagaggact gtttaacaaa      1980
     tacattgctt tctgtaaa                                                    1998
//


spacer
spacer