spacer

EBI Dbfetch

ID   FN256435; SV 2; linear; genomic DNA; STD; HUM; 763 BP.
XX
AC   FN256435; FN256436;
XX
DT   13-MAR-2009 (Rel. 100, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, allele
DE   HLA-DQB1*06new, exon 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-763
RA   Skrablin P.S.A.;
RT   ;
RL   Submitted (12-MAR-2009) to the INSDC.
RL   Skrablin P.S.A., Institute of Transfusion Medicine and Immunohematology,
RL   RCBDS Baden-Wuerttemberg - Hessen, Sandhofstrasse 1, 60528 Frankfurt,
RL   Hessen, GERMANY.
XX
RN   [2]
RA   Skrablin P.S., Richter R., Seidl C., Seifried E.;
RT   "New HLA-DQB1*06 allele found in a voluntary blood stem cell donor";
RL   Unpublished.
XX
DR   MD5; bbcc8124be6896126458c9ffab13b5c8.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..763
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /collected_by="Edith Streit"
FT                   /collection_date="10-Apr-2008"
FT                   /sex="male"
FT                   /pop_variant="caucasian"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAX62164.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   CDS             <371..>763
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:36"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAX62165.1"
FT                   /translation="EPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVQWFRNDQEETA
FT                   GVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITAEWRAQSESAQSKM
FT                   LSGVGGFVLGLIFLGLGLIIRQRSQK"
FT   exon            371..763
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=3
XX
SQ   Sequence 763 BP; 145 A; 180 C; 212 G; 126 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag gccagatcaa agtccagtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca ccccccttat taggaatggt       540
     gactggactt tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgcggagtg gcgggctcag       660
     tctgaatctg cccagagcaa gatgctgagt ggcgttggag gcttcgtgct ggggctgatc       720
     ttccttgggc tgggccttat catccgtcaa aggagtcaga aag                         763
//


spacer
spacer