spacer

EBI Dbfetch

ID   FN256254; SV 1; linear; genomic DNA; STD; HUM; 900 BP.
XX
AC   FN256254;
XX
DT   12-MAR-2009 (Rel. 100, Created)
DT   12-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*8501
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-900
RA   Witter K.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 308ef28e5ce4a2d22ad4dea0b7ae4e4f.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..900
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..40
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /number=1
FT   CDS             join(<41..304,484..>765)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*85:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX53718.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQHRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /number=2
FT   intron          305..483
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /number=2
FT   gap             327..426
FT                   /estimated_length=unknown
FT   exon            484..765
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /number=3
FT   intron          766..>900
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8501"
FT                   /number=3
XX
SQ   Sequence 900 BP; 181 A; 229 C; 231 G; 159 T; 100 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gtaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt acgcgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg ctgcggagta ctggaacagc cagaaggaca tcctggagga gaagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcac       300
     cgaggtgagt gagggctttg ggccggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnaagg aagggaagga caatctcaaa tgctatttca ttattttcct tccccactcg       480
     tagtccagcc taaggtgaac gtttccccct ccaagaaggg gcccctgcag caccacaacc       540
     tgcttgtctg ccacgtgaca gatttctacc caggcagcat tcaagtccga tggttcctga       600
     atggacagga ggaaacagct ggggtcgtgt ccaccaacct gatccgtaat ggagactgga       660
     ccttccagat cctggtgatg ctggaaatga ccccccagca gggagacgtc tacatctgcc       720
     aagtggagca caccagcctg gacagtcctg tcaccgtgga gtggagtgag tctctgatga       780
     ccgtctagac cccacctctg aagagcaggg gactctctgg ctctggggtc cactcatctt       840
     atcttctgca tctatagcca tgtccaaacc ccatctttct tctataccag ctcctgagca       900
//


spacer
spacer