spacer

EBI Dbfetch

ID   FN256253; SV 1; linear; genomic DNA; STD; HUM; 944 BP.
XX
AC   FN256253;
XX
DT   12-MAR-2009 (Rel. 100, Created)
DT   12-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*5501
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-944
RA   Witter K.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 9191d3a384da27d0ff3714fd705a597d.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..944
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..40
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /number=1
FT   CDS             join(<41..304,520..>801)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*55:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX53726.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /number=2
FT   intron          305..519
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /number=2
FT   gap             328..427
FT                   /estimated_length=unknown
FT   exon            520..801
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /number=3
FT   intron          802..>944
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5501"
FT                   /number=3
XX
SQ   Sequence 944 BP; 195 A; 229 C; 253 G; 167 T; 100 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gcaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg ctgcggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttg gggccggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnaag gaaggaagga aggaaggaag gaaggaagga aggaaggaaa gaaggacaat       480
     ctcaaattct atttcattat ttttcttcca cgctcctagt ccagcctagg gtgaatgttt       540
     ccccctccaa gaaggggccc ttgcagcacc acaacctgct tgtctgccac gtgacggatt       600
     tctacccagg cagcattcaa gtccgatggt tcctgaatgg acaggaggaa acagctgggg       660
     tcgtgtccac caacctgatc cgtaatggag actggacctt ccagatcctg gtgatgctgg       720
     aaatgacccc ccagcaggga gatgtctaca cctgccaagt ggagcacacc agcctggata       780
     gtcctgtcac cgtggagtgg agtgagtctc tgatgaccct ctagacccca cctctgaaga       840
     gcaggggact ctctggctct ggggtccact catcttatct tctgcatcta taccctgggg       900
     ccatgtccaa accccatctt tcttctatac cagctcctga gcat                        944
//


spacer
spacer