Dbfetch

ID   FN256252; SV 2; linear; genomic DNA; STD; HUM; 759 BP.
XX
AC   FN256252;
XX
DT   12-MAR-2009 (Rel. 100, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*3501
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Witter K.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
RN   [3]
RP   1-759
RA   Witter K.;
RT   ;
RL   Submitted (18-JUN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
DR   MD5; a668d296742b7776e06ec136cc8a6ab1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..759
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..31
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /number=1
FT   CDS             join(<32..295,458..>739)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C0MPQ4"
FT                   /db_xref="IMGT/HLA:DPB1*35:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C0MPQ4"
FT                   /protein_id="CAX53724.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQSRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            32..295
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /number=2
FT   intron          296..457
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /number=2
FT   gap             313..412
FT                   /estimated_length=unknown
FT   exon            458..739
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /number=3
FT   intron          740..>759
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3501"
FT                   /number=3
XX
SQ   Sequence 759 BP; 150 A; 185 C; 196 G; 128 T; 100 other;
     gcctccgctc atgtccgccc cctccccgca gagaattacg ttcaccagtt acggcaggaa        60
     tgctacgcgt ttaatgggac acagcgcttc ctggagagat acatctacaa ccgggaggag       120
     ttcgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       180
     gatgaggact actggaacag ccagaaggac atcctggagg agaagcgggc agtgccggac       240
     agggtatgca gacacaacta cgagctggac gaggccgtga ccctgcagag ccgaggtgag       300
     tgagggcttt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngacaatct       420
     caaatgctat ttcattattt tccttcccca ctcgtagtcc agcctaaggt gaacgtttcc       480
     ccctccaaga aggggcccct gcagcaccac aacctgcttg tctgccacgt gacagatttc       540
     tacccaggca gcattcaagt ccgatggttc ctgaatggac aggaggaaac agctggggtc       600
     gtgtccacca acctgatccg taatggagac tggaccttcc agatcctggt gatgctggaa       660
     atgacccccc agcagggaga cgtctacatc tgccaagtgg agcacaccag cctggacagt       720
     cctgtcaccg tggagtggag tgagtctctg atgaccgtc                              759
//