Dbfetch

ID   FN256251; SV 1; linear; genomic DNA; STD; HUM; 760 BP.
XX
AC   FN256251;
XX
DT   12-MAR-2009 (Rel. 100, Created)
DT   12-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*4501
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-760
RA   Witter K.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; adb09a8f15b7dbaa75809fe30611b63d.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..760
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..31
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /number=1
FT   CDS             join(<32..295,459..>740)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*45:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX53721.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            32..295
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /number=2
FT   intron          296..458
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /number=2
FT   gap             313..412
FT                   /estimated_length=unknown
FT   exon            459..740
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /number=3
FT   intron          741..>760
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*4501"
FT                   /number=3
XX
SQ   Sequence 760 BP; 148 A; 186 C; 199 G; 127 T; 100 other;
     gcctccgctc atgtccgccc cctccccgca gagaattacg tgcaccagtt acggcaggaa        60
     tgctacgcgt ttaatgggac acagcgcttc ctggagagat acatctacaa ccgggaggag       120
     ttcgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       180
     gatgaggagt actggaacag ccagaaggac ctcctggagg agaagcgggc agtgccggac       240
     agggtatgca gacacaacta cgagctggac gaggccgtga ccctgcagcg ccgaggtgag       300
     tgagggcttt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnggacaatc       420
     tcaaatgcta tttcattatt ttccttcccc actcgtagtc cagcctaagg tgaacgtttc       480
     cccctccaag aaggggcccc tgcagcacca caacctgctt gtctgccacg tgacagattt       540
     ctacccaggc agcattcaag tccgatggtt cctgaatgga caggaggaaa cagctggggt       600
     cgtgtccacc aacctgatcc gtaatggaga ctggaccttc cagatcctgg tgatgctgga       660
     aatgaccccc cagcagggag acgtctacat ctgccaagtg gagcacacca gcctggacag       720
     tcctgtcacc gtggagtgga gtgagtctct gatgaccgtc                             760
//