spacer

EBI Dbfetch

ID   FN256250; SV 1; linear; genomic DNA; STD; HUM; 761 BP.
XX
AC   FN256250;
XX
DT   12-MAR-2009 (Rel. 100, Created)
DT   12-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*8801
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-761
RA   Witter K.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; be6a5d79fb3d8f094fd5c687a8981103.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..761
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..31
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /number=1
FT   CDS             join(<32..295,460..>741)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*88:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX53717.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEERAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            32..295
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /number=2
FT   intron          296..459
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /number=2
FT   gap             313..412
FT                   /estimated_length=unknown
FT   exon            460..741
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /number=3
FT   intron          742..>761
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*8801"
FT                   /number=3
XX
SQ   Sequence 761 BP; 149 A; 185 C; 199 G; 128 T; 100 other;
     gcctccgctc atgtccgccc cctccccgca gagaattacg tgtaccagtt acggcaggaa        60
     tgctacgcgt ttaatgggac acagcgcttc ctggagagat acatctacaa ccgggaggag       120
     ttcgtgcgct tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct       180
     gatgaggact actggaacag ccagaaggac atcctggagg aggagcgggc agtgccggac       240
     agggtatgca gacacaacta cgagctggac gaggccgtga ccctgcagcg ccgaggtgag       300
     tgagggcttt ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnaggacaat       420
     ctcaaatgct atttcattat tttccttccc cactcgtagt ccagcctaag gtgaacgttt       480
     ccccctccaa gaaggggccc ctgcagcacc acaacctgct tgtctgccac gtgacagatt       540
     tctacccagg cagcattcaa gtccgatggt tcctgaatgg acaggaggaa acagctgggg       600
     tcgtgtccac caacctgatc cgtaatggag actggacctt ccagatcctg gtgatgctgg       660
     aaatgacccc ccagcaggga gacgtctaca tctgccaagt ggagcacacc agcctggaca       720
     gtcctgtcac cgtggagtgg agtgagtctc tgatgaccgt c                           761
//


spacer
spacer