spacer

EBI Dbfetch

ID   FN252853; SV 1; linear; genomic DNA; STD; HUM; 777 BP.
XX
AC   FN252853;
XX
DT   11-MAR-2009 (Rel. 100, Created)
DT   11-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen,
DE   HLA-DPB1*260102 allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-777
RA   Witter K.;
RT   ;
RL   Submitted (10-MAR-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Tran H., Sabine S.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 8aa81ba0da07f7c9cadffc62a429b6be.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..777
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..30
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /number=1
FT   CDS             join(<31..294,466..>747)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*26:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX53275.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            31..294
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /number=2
FT   intron          295..465
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /number=2
FT   gap             320..419
FT                   /estimated_length=unknown
FT   exon            466..747
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /number=3
FT   intron          748..>777
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*260102"
FT                   /number=3
XX
SQ   Sequence 777 BP; 152 A; 193 C; 204 G; 128 T; 100 other;
     gctccgctca tgtccgcccc ctccccgcag agaattacgt gtaccagtta cggcaggaat        60
     gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac cgggaggagt       120
     acgcgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg       180
     ctgcggagta ctggaacagc cagaaggaca tcctggagga gaagcgggca gtgccggaca       240
     gggtatgcag acacaactac gagctggacg aggccgtgac cctgcagcgc cgaggtgagt       300
     gagggctttg ggccggcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng       420
     gacaatctca aatgctattt cattattttt cttccccact cgtagtccag cctaaggtga       480
     acgtttcccc ctccaagaag gggcccctgc agcaccacaa cctgcttgtc tgccacgtga       540
     cagatttcta cccaggcagc attcaagtcc gatggttcct gaatggacag gaggaaacag       600
     ctggggtcgt gtccaccaac ctgatccgta atggagactg gaccttccag atcctggtga       660
     tgctggaaat gaccccccag cagggagacg tctacatctg ccaagtggag cacaccagcc       720
     tggacagtcc tgtcaccgtg gagtggagtg agtctctgat gaccatctag accccac          777
//


spacer
spacer