Dbfetch

ID   FN252190; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN252190;
XX
DT   07-JUN-2009 (Rel. 101, Created)
DT   07-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*03new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (06-MAR-2009) to the INSDC.
RL   Poli F., Medicina Rigenerativa, Ospedale Maggiore Policlinico di Milano,
RL   Via Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB1*03 by direct sequencing";
RL   Unpublished.
XX
DR   MD5; 1b55d1fd1fc552ebfaa007ae549a64c2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:C5J8E7"
FT                   /db_xref="IMGT/HLA:DRB1*03:05:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C5J8E7"
FT                   /protein_id="CAX51966.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 63 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//