Dbfetch

ID   FM998813; SV 1; linear; genomic DNA; STD; HUM; 1765 BP.
XX
AC   FM998813;
XX
DT   13-FEB-2009 (Rel. 99, Created)
DT   13-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*01New
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1765
RA   Dormoy A.;
RT   ;
RL   Submitted (13-FEB-2009) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B.;
RT   "The Cw*01new allele is identical to the allele Cw*010201 except a
RT   substitution at nucleotide position 818 (T->C) leading to the change of the
RT   amino acid 249 (Val(GTG) ->(Ala(GCG))";
RL   Unpublished.
XX
DR   MD5; 0a63783a6ae1665a9c41c00ad0e99394.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1765
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala C-9*3, fwd_seq:
FT                   mtcctgctgctctcgggagc, rev_name: P3' Intron 4C, rev_seq:
FT                   ctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   intron          <1..16
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=1
FT   CDS             join(<17..286,533..808,1396..>1671)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*01:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:B9WPX4"
FT                   /protein_id="CAX44302.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVMAPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            17..286
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=2
FT   intron          287..532
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=2
FT   exon            533..808
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=3
FT   intron          809..1395
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=3
FT   exon            1396..1671
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=4
FT   intron          1672..>1765
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*01New"
FT                   /number=4
XX
SQ   Sequence 1765 BP; 342 A; 530 C; 572 G; 321 T; 0 other;
     ccctcctcgc ccccaggctc ccactccatg aagtatttct tcacatccgt gtcccggcct        60
     ggccgcggag agccccgctt catctcagtg ggctacgtgg acgacacgca gttcgtgcgg       120
     ttcgacagcg acgccgcgag tccgagaggg gagccgcggg cgccgtgggt ggagcaggag       180
     gggccggagt attgggaccg ggagacacag aagtacaagc gccaggcaca gactgaccga       240
     gtgagcctgc ggaacctgcg cggctactac aaccagagcg aggccggtga gtgaccccgg       300
     cccggggcgc aggtcacgac ccctcctcat cccccacgga cggcccgggt cgccccaagt       360
     ctcccggtct gagatccacc ccgaggctgc ggaacccgcc cagaccctcg accggagaga       420
     gccccagtca cctttacccg gtttcatttt cagtttaggc caaaatcccc gcgggttggt       480
     cgggactggg gcggggctcg ggggacgggg ctgaccacgg gggcggggcc agggtctcac       540
     accctccagt ggatgtgtgg ctgcgacctg gggcccgacg ggcgcctcct ccgcgggtat       600
     gaccagtacg cctacgacgg caaggattac atcgccctga acgaggacct gcgctcctgg       660
     accgccgcgg acaccgcggc tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg       720
     gagcagcgga gagcctacct ggagggcacg tgcgtggagt ggctccgcag atacctggag       780
     aacgggaagg agacgctgca gcgcgcgggt accaggggca gtggggagcc ttccccatct       840
     cccgtagatc tcccggcatg gcctcccacg aggaggggag gaaaatggga tcagcgctag       900
     aatatcgccc tcccttgaat ggagaatggg atgagttttc ctgagtttcc tctgagggcc       960
     ccctctgctc tctaggacaa ttaagggatg aagtccttga ggaaatggag gggaagacag      1020
     tccctggaat actgatcagg ggtccccttt gaccactttg accactgcag cagctgtggt      1080
     caggctgctg acctttctct caggccttgt tctctgcctc acgctcaatg tgtttgaagg      1140
     tttgattcca gcttttctga gtccttcggc ctccactcag gtcaggacca gaagtcgctg      1200
     ttcctccctc agagactaga actttccaat gaataggaga ttatcccagg tgcctgtgtc      1260
     caggctggcg tctgggttct gtgccccctt ccccacccca ggtgtcctgt ccattctcag      1320
     gatggtcaca tgggcgctgt tggagtgtcg caagagagat acaaagtgtc tgaattttct      1380
     gactcttccc gtcagaacac ccaaagacac acgtgaccca ccatcccgtc tctgaccatg      1440
     aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc      1500
     agtgggatgg ggaggaccaa actcaggaca ccgagcttgt ggagaccagg ccagcaggag      1560
     atggaacctt ccagaagtgg gcagctgtga tggcgccttc tggagaagag cagagataca      1620
     cgtgccatgt gcagcacgag gggctgccgg agcccctcac cctgagatgg ggtaaggagg      1680
     gggatgaggg gtgatgtgtc ttctcaggga aagcagaagt cctggagccc ttcagccggg      1740
     tcagggctga ggcttggagg tcagg                                            1765
//