Dbfetch

ID   FM998810; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FM998810;
XX
DT   24-FEB-2009 (Rel. 99, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*07variant allele, isolate AKB-642962, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-FEB-2009) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str.1/Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01348.x.
RX   PUBMED; 19845906.
RA   Wurm M., Tischer S., Immenschuh S., Blasczyk R., Eiz-Vesper B.;
RT   "The predicted protein structures of the novel DRB1*0717 and DRB1*0701 are
RT   highly related";
RL   Tissue Antigens 74(5):460-462(2009).
XX
DR   MD5; c37fac832454f5bfde83d1c1a053ae51.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="AKB-642962"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_type="PBMCs"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:C0MP10"
FT                   /db_xref="IMGT/HLA:DRB1*07:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C0MP10"
FT                   /protein_id="CAX48960.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRWGQVDTVCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 62 C; 100 G; 50 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg tggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//