spacer

EBI Dbfetch

ID   FM998808; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FM998808;
XX
DT   24-FEB-2009 (Rel. 99, Created)
DT   24-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*03variant allele, isolate N-634755, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (12-FEB-2009) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str.1/Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Figueiredo C., Mueller K., Horn P.A., Eiz-Vesper B., Blasczyk R.;
RT   "A novel HLA-DRB1*03 allele";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="N-634755"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_type="PBMCs"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:C0MP08"
FT                   /db_xref="IMGT/HLA:DRB1*03:13:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:C0MP08"
FT                   /protein_id="CAX48958.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAESWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 64 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer