Dbfetch

ID   FM995501; SV 1; linear; genomic DNA; STD; HUM; 1239 BP.
XX
AC   FM995501;
XX
DT   06-FEB-2009 (Rel. 99, Created)
DT   06-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*0757new
DE   allele, exons 2-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1239
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (06-FEB-2009) to the INSDC.
RL   Anholts J.D.H., Immunohematology and Blood Transfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "New sequences found during routine HLA typing";
RL   Unpublished.
XX
DR   MD5; 0ecd81e11c15f3b06fffc75f021bc1d7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1239
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..1022,1123..>1239)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0757new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B9WPQ8"
FT                   /db_xref="IMGT/HLA:B*07:75"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B9WPQ8"
FT                   /protein_id="CAX33899.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTYRENLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTV
FT                   PIVGIVAGLAVLAVVVIGAVVAAVMCRRKSS"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0757new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0757new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0757new"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..1239
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0757new"
FT                   /number=5
XX
SQ   Sequence 1239 BP; 196 A; 285 C; 313 G; 145 T; 300 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactta ccgagagaac ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctgnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca cacgtgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggt ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1020
     ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnagccgtct tcccagtcca      1140
     ccgtccccat cgtgggcatt gttgctggcc tggctgtcct agcagttgtg gtcatcggag      1200
     ctgtggtcgc tgctgtgatg tgtaggagga agagttcag                             1239
//