spacer

EBI Dbfetch

ID   FM995216; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FM995216;
XX
DT   06-FEB-2009 (Rel. 99, Created)
DT   18-NOV-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B14*new
DE   allele, exon 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Emmerich F.;
RT   ;
RL   Submitted (03-FEB-2009) to the INSDC.
RL   Emmerich F., Transfusionsmedizin, Universitaetsklinikum Freiburg,
RL   Hugstetter Str. 55, Freiburg, 79106, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2010.01541.x.
RX   PUBMED; 20663100.
RA   Emmerich F., Daskalakis M., Niemeyer C.;
RT   "A novel HLA-B allele, B*14:10, identified by haplotype-specific
RT   sequencing";
RL   Tissue Antigens 76(6):497-498(2010).
XX
RN   [3]
RP   1-646
RA   Emmerich F.;
RT   ;
RL   Submitted (17-FEB-2009) to the INSDC.
RL   Emmerich F., Transfusionsmedizin, Universitaetsklinikum Freiburg,
RL   Hugstetter Str. 55, Freiburg, 79106, GERMANY.
XX
DR   MD5; d821be2adfdc8913286c3aac2ca053fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B14*new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B9WPP2"
FT                   /db_xref="IMGT/HLA:B*14:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B9WPP2"
FT                   /protein_id="CAX33860.2"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*14new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*14new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 115 A; 169 C; 191 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer