spacer

EBI Dbfetch

ID   FM993984; SV 1; linear; mRNA; STD; MAM; 585 BP.
XX
AC   FM993984;
XX
DT   03-MAR-2009 (Rel. 100, Created)
DT   07-JAN-2010 (Rel. 103, Last updated, Version 3)
XX
DE   Ovis aries partial mRNA for T-cell receptor beta chain (TRB gene), clone
DE   pSTA.29
XX
KW   .
XX
OS   Ovis aries (sheep)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Caprinae; Ovis.
XX
RN   [1]
RP   1-585
RA   Di Tommaso S.;
RT   ;
RL   Submitted (10-DEC-2008) to the INSDC.
RL   Di Tommaso S., Department of Biological and Environmental Sciences and
RL   Technologies, University of Salento, Prov.le Lecce-Monteroni, Centro
RL   Ecotekne, Lecce, 73100, ITALY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-11-3.
RX   PUBMED; 20047680.
RA   Di Tommaso S., Antonacci R., Ciccarese S., Massari S.;
RT   "Extensive analysis of D-J-C arrangements allows the identification of
RT   different mechanisms enhancing the diversity in sheep T cell receptor
RT   beta-chain repertoire";
RL   BMC Genomics 11:3-3(2010).
XX
DR   MD5; 5bf923050f1d19d66813acf793deb069.
DR   EuropePMC; PMC2806336; 20047680.
DR   IMGT/LIGM; FM993984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..585
FT                   /organism="Ovis aries"
FT                   /mol_type="mRNA"
FT                   /country="Italy:Puglia"
FT                   /clone="pSTA.29"
FT                   /cell_type="T-lymphocyte"
FT                   /tissue_type="thymus"
FT                   /rearranged
FT                   /note="breed:Gentile di Puglia"
FT                   /db_xref="taxon:9940"
FT   CDS             <1..>585
FT                   /codon_start=1
FT                   /gene="TRB"
FT                   /product="T-cell receptor beta chain"
FT                   /protein_id="CAX32952.1"
FT                   /translation="YLCASSPRQTGPFGEYHFGPGTKLTVVDDLSRVHPPKVAVFEPSE
FT                   AEISRTQKATLVCLATGFYPDHVELTWWVNRKQVTTGVSTDPEPYKEDLTQNDSRYCLS
FT                   SRLRVTAAFWHNPRNHFRCQVQFYGLTDQDQWEEQDRDKPVTQNISAETWGRADCGVTS
FT                   ASYQQGVLSATLLYEILLGKATLYAVLVSALV"
FT   V_segment       <1..>20
FT                   /gene="TRBV"
FT   D_segment       <27..>31
FT                   /gene="TRBD1"
FT   J_segment       <42..>81
FT                   /gene="TRBJ1-2"
FT   C_region        <82..>585
FT                   /gene="TRBC1"
XX
SQ   Sequence 585 BP; 124 A; 193 C; 172 G; 96 T; 0 other;
     tatctctgtg ccagcagccc cagacagaca ggacccttcg gtgaatatca cttcggccca        60
     gggaccaagc tgacagttgt agacgatctg agccgggtgc acccgcccaa ggtggctgtg       120
     ttcgaaccct cggaagcaga gatctcccgg acccagaagg ccaccctcgt gtgcctggcc       180
     acgggcttct accccgacca cgtggagctg acctggtggg tgaacaggaa gcaggtcacc       240
     actggggtca gcacggaccc tgagccctac aaagaggacc tcacgcagaa tgactccaga       300
     tactgtctga gcagccggct gagggtgacc gccgccttct ggcacaaccc ccgcaaccac       360
     ttccgatgcc aagtccagtt ctacgggctc acggaccagg accagtggga ggagcaggac       420
     agggacaagc ccgtcaccca gaacatcagc gccgagacct ggggcagagc agactgtggc       480
     gtcacctccg cgtcttatca gcaaggcgtc ctgtctgcca ccctcctcta tgagatcctg       540
     ctggggaagg ccaccctgta tgctgtgctg gtcagcgccc tggtg                       585
//


spacer
spacer