Dbfetch

ID   FM992853; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FM992853;
XX
DT   30-JAN-2009 (Rel. 99, Created)
DT   05-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*58variant
DE   allele, exons 2-3, isolate DEAKB_721296
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Blasczyk R.;
RT   ;
RL   Submitted (29-JAN-2009) to the INSDC.
RL   Blasczyk R., Hannover Medical School, Institue for Transfusion Medicine,
RL   Carl-Neuberg-Strasse, Hannover, 30626, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/tan.12059.
RX   PUBMED; 23350729.
RA   Tischer S., Bunse C., Figueiredo C., Immenschuh S., Blasczyk R.,
RA   Eiz-Vesper B.;
RT   "The new  HLA-B*58:21 allele is predicted to be functionally similar to the
RT   B*58:01P group of alleles";
RL   Tissue Antigens 81(3):178-179(2013).
XX
DR   MD5; d2a781c33a11d6aa6f5f995e6a549a6b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /isolate="DEAKB_721296"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B*58"
FT                   /allele="HLA-B*58variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*58:21"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B9WN87"
FT                   /protein_id="CAX32458.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSETGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B*58"
FT                   /allele="HLA-B*58variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B*58"
FT                   /allele="HLA-B*58variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 173 C; 192 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgagaccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//