spacer

EBI Dbfetch

ID   FM992687; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FM992687;
XX
DT   28-JAN-2009 (Rel. 99, Created)
DT   27-AUG-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, HLA-Cw*05new
DE   allele, exons 2-3, isolate C-629058
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Blasczyk R.;
RT   ;
RL   Submitted (21-JAN-2009) to the INSDC.
RL   Blasczyk R., Institut for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01310.x.
RX   PUBMED; 19624482.
RA   Figueiredo C., Jaimes Y., Horn P.A., Blasczyk R., Eiz-Vesper B.;
RT   "The new HLA-Cw*0524 allele increase the variability of position 49 in
RT   HLA-C";
RL   Tissue Antigens 74(3):258-259(2009).
XX
DR   MD5; ebcd07e4714be84320bab9fa6c6cdb54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="C-629058"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*05new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B9W6G1"
FT                   /db_xref="IMGT/HLA:C*05:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B9W6G1"
FT                   /protein_id="CAX30810.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRGPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*05new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*05new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 167 C; 197 G; 70 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggggccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat       480
     gaggacctgc gctcctggac cgccgcggac aaggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaagaag acgctgcagc gcgcgg                      646
//


spacer
spacer