Dbfetch

ID   FM992366; SV 1; linear; genomic DNA; STD; HUM; 946 BP.
XX
AC   FM992366;
XX
DT   27-JAN-2009 (Rel. 99, Created)
DT   27-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*0601, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-946
RA   Witter K.;
RT   ;
RL   Submitted (23-JAN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 42ebe8c2149923089b06ba548b6e7bea.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..946
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<41..304,523..>804)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0601"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX30407.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDLLEEERAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0601"
FT                   /number=2
FT   intron          join(305..>321,<471..522)
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0601"
FT                   /number=2
FT   gap             322..470
FT                   /estimated_length=149
FT   exon            523..804
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0601"
FT                   /number=3
XX
SQ   Sequence 946 BP; 176 A; 229 C; 230 G; 162 T; 149 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gtaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggacta ctggaacagc cagaaggacc tcctggagga ggagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn agggaaggac       480
     aatctcaaat gctatttcat tattttcctt ccccactcgt agtccagcct aaggtgaacg       540
     tttccccctc caagaagggg cccctgcagc accacaacct gcttgtctgc cacgtgacag       600
     atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag gaaacagctg       660
     gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc ctggtgatgc       720
     tggaaatgac cccccagcag ggagacgtct acatctgcca agtggagcac accagcctgg       780
     acagtcctgt caccgtggag tggagtgagt ctctgatgac cgtctagacc ccacctctga       840
     agagcagggg actctctggc tctggggtcc actcatctta tcttctgcat ctataccctg       900
     gggccatgtc caaaccccat ctttcttcta taccagctcc tgagca                      946
//