spacer

EBI Dbfetch

ID   FM992080; SV 2; linear; genomic DNA; STD; HUM; 949 BP.
XX
AC   FM992080;
XX
DT   26-JAN-2009 (Rel. 99, Created)
DT   03-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1601
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Witter K.;
RT   ;
RL   Submitted (22-JAN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
RN   [3]
RP   1-949
RA   Witter K.;
RT   ;
RL   Submitted (02-SEP-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
DR   MD5; 45859dc49ed23c1509f46f78874aee30.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..949
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<40..304,529..>810)
FT                   /codon_start=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1601"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*16:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX21583.2"
FT                   /translation="ENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVT
FT                   ELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQ
FT                   HHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGD
FT                   VYICQVEHTSLDSPVTVEW"
FT   exon            40..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1601"
FT                   /number=2
FT   intron          305..528
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1601"
FT                   /number=2
FT   gap             330..474
FT                   /estimated_length=145
FT   exon            529..810
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1601"
FT                   /number=3
XX
SQ   Sequence 949 BP; 176 A; 230 C; 236 G; 162 T; 145 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacct tttccaggga        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttg ggccggcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngaaggg       480
     aaggacaatc tcaaatgcta tttcattatt ttccttcccc actcgtagtc cagcctaagg       540
     tgaacgtttc cccctccaag aaggggcccc tgcagcacca caacctgctt gtctgccacg       600
     tgacagattt ctacccaggc agcattcaag tccgatggtt cctgaatgga caggaggaaa       660
     cagctggggt cgtgtccacc aacctgatcc gtaatggaga ctggaccttc cagatcctgg       720
     tgatgctgga aatgaccccc cagcagggag acgtctacat ctgccaagtg gagcacacca       780
     gcctggacag tcctgtcacc gtggagtgga gtgagtctct gatgaccgtc tagaccccac       840
     ctctgaagag caggggactc tctggctctg gggtccactc atcttatctt ctgcatctat       900
     accctggggc catgtccaaa ccccatcttt cttctatacc agctcctga                   949
//


spacer
spacer