spacer

EBI Dbfetch

ID   FM991729; SV 1; linear; genomic DNA; STD; HUM; 1039 BP.
XX
AC   FM991729;
XX
DT   23-JAN-2009 (Rel. 99, Created)
DT   23-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1801
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1039
RA   Witter K.;
RT   ;
RL   Submitted (20-JAN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 9973cd1a7b2f6148384c6b3fe8de7bc0.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1039
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..40
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /number=1
FT   CDS             join(<41..304,617..>898)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*18:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX20314.1"
FT                   /translation="NYVYQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELVGPMTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /number=2
FT   intron          305..616
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /number=2
FT   gap             327..455
FT                   /estimated_length=129
FT   exon            617..898
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /number=3
FT   intron          899..>1039
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1801"
FT                   /number=3
XX
SQ   Sequence 1039 BP; 218 A; 256 C; 258 G; 178 T; 129 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gtaccaggga        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggagta ctggaacagc cagaaggaca tcctggagga gaagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggtcg ggcccatgac cctgcagcgc       300
     cgaggtgagt gagggctttg ggccggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngttgc agtgagccaa tattgcgcca       480
     ctgcattcca gacttggcaa cagagcgaca ctccacctca acaaaaagaa agaaagagcg       540
     agattacgtc tcaaaaaagg aaggaaggaa ggacaatctc aaatgctatt tcattatttt       600
     ccttccccac tcgtagtcca gcctaaggtg aacgtttccc cctccaagaa ggggcccctg       660
     cagcaccaca acctgcttgt ctgccacgtg acagatttct acccaggcag cattcaagtc       720
     cgatggttcc tgaatggaca ggaggaaaca gctggggtcg tgtccaccaa cctgatccgt       780
     aatggagact ggaccttcca gatcctggtg atgctggaaa tgacccccca gcagggagac       840
     gtctacatct gccaagtgga gcacaccagc ctggacagtc ctgtcaccgt ggagtggagt       900
     gagtctctga tgaccgtcta gaccccacct ctgaagagca ggggactctc tggctctggg       960
     gtccactcat cttatcttct gcatctatac cctggggcca tgtccaaacc ccatctttct      1020
     tctataccag ctcctgagc                                                   1039
//


spacer
spacer