Dbfetch

ID   FM956650; SV 1; linear; genomic DNA; STD; HUM; 953 BP.
XX
AC   FM956650;
XX
DT   10-JAN-2009 (Rel. 98, Created)
DT   10-JAN-2009 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*2301
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-953
RA   Witter K.;
RT   ;
RL   Submitted (09-JAN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 9bbbc737773b1170283ffb1fc46eb7f0.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..953
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..28
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /number=1
FT   CDS             join(<29..292,527..>808)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*23:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAX11690.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            29..292
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /number=2
FT   intron          293..526
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /number=2
FT   gap             312..442
FT                   /estimated_length=131
FT   exon            527..808
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /number=3
FT   intron          809..>953
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2301"
FT                   /number=3
XX
SQ   Sequence 953 BP; 189 A; 226 C; 240 G; 167 T; 131 other;
     tccgctcatg tccgccccct ccccgcagag aattaccttt tccagggacg gcaggaatgc        60
     tacgcgttta atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagttc       120
     gtgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgct       180
     gcggagtact ggaacagcca gaaggacatc ctggaggaga agcgggcagt gccggacagg       240
     atgtgcagac acaactacga gctgggcggg cccatgaccc tgcagcgccg aggtgagtga       300
     gggctttggg cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnaaggaagg aaggaaggaa ggaaggaagg aaggaaagaa       480
     ggacaatctc aaattctatt tcattatttt tcttccacgc tcctagtcca gcctagggtg       540
     aatgtttccc cctccaagaa ggggcccttg cagcaccaca acctgcttgt ctgccacgtg       600
     acggatttct acccaggcag cattcaagtc cgatggttcc tgaatggaca ggaggaaaca       660
     gctggggtcg tgtccaccaa cctgatccgt aatggagact ggaccttcca gatcctggtg       720
     atgctggaaa tgacccccca gcagggagat gtctacacct gccaagtgga gcacaccagc       780
     ctggatagtc ctgtcaccgt ggagtggagt gagtctctga tgaccctcta gaccccacct       840
     ctgaagagca ggggactctc tggctctggg gtccactcat cttatcttct gcatctatac       900
     cctggggcca tgtccaaacc ccatctttct tctataccag ctcctgagca tag              953
//