spacer

EBI Dbfetch

ID   FM955271; SV 2; linear; genomic DNA; STD; HUM; 3031 BP.
XX
AC   FM955271;
XX
DT   19-DEC-2008 (Rel. 98, Created)
DT   20-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*66new allele
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Witter K.;
RT   ;
RL   Submitted (18-DEC-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Characterization of a novel HLA-A allele, A*66new";
RL   Unpublished.
XX
RN   [3]
RP   1-3031
RA   Witter K.;
RT   ;
RL   Submitted (06-JAN-2011) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
DR   MD5; faab5441bdfd4a19d0fca266d0dde466.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3031
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..35
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT   exon            <1..108
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=1
FT   CDS             join(36..108,239..508,750..1025,1626..1901,2001..2117,
FT                   2556..2588,2731..2778,2948..2952)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B7VU66"
FT                   /db_xref="IMGT/HLA:A*66:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7VU66"
FT                   /protein_id="CAV31552.2"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTVQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   intron          109..238
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=1
FT   exon            239..508
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=2
FT   intron          509..749
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=2
FT   exon            750..1025
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=3
FT   intron          1026..1625
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=3
FT   exon            1626..1901
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=4
FT   intron          1902..2000
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=4
FT   exon            2001..2117
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=5
FT   intron          2118..2555
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=5
FT   exon            2556..2588
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=6
FT   intron          2589..2730
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=6
FT   exon            2731..2778
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=7
FT   intron          2779..2947
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=7
FT   exon            2948..3031
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
FT                   /number=8
FT   3'UTR           2953..3031
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*66new"
XX
SQ   Sequence 3031 BP; 578 A; 869 C; 949 G; 635 T; 0 other;
     cccaccggga ctcagattct ccccagacgc cgaggatggc cgtcatggcg ccccgaaccc        60
     tcgtcctgct actctcgggg gccctggccc tgacccagac ctgggcgggt gagtgcgggg       120
     tcgggaggga aacggcctct gtggggagaa gcaaggggcc cgcccggcgg gggcgcagga       180
     cccgggaagc cgcgcctgga ggagggtcgg gcgggtctca gccactcctc gcccccaggc       240
     tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc       300
     ttcatcgccg tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg       360
     agccagagga tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac       420
     cggaacacac ggaatgtgaa ggcccagtca cagactgacc gagtggacct ggggaccctg       480
     cgcggctact acaaccagag cgaggacggt gagtgacccc ggcccggggc gcaggtcacg       540
     acccctcatc ccccacggac gggccaggtc gcccacagtc tccgggtccg agatccgccc       600
     cgaagccgcg ggaccccgag acccttgccc cgggagaggc ccaggcgcct ttacccggtt       660
     tcattttcag tttaggccaa aaatcccccc gggttggtcg gggcggggcg gggctcgggg       720
     gaccgggctg acctcggggt ccgggccagg ttctcacacc gtccagagga tgtatggctg       780
     cgacgtgggg ccggacgggc gcttcctccg cgggtaccag caggacgctt acgacggcaa       840
     ggattacatc gccctgaacg aggacctgcg ctcttggacc gcggcggaca tggcggctca       900
     gatcacccag cgcaagtggg agacggccca tgaggcggag cagtggagag cctacctgga       960
     gggccggtgc gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg      1020
     cacgggtacc aggggccacg gggcgcctcc ctgatcgcct gtagatctcc cgggctggcc      1080
     tcccacaagg aggggagaca attgggacca acactagaat atcgccctcc ctctggtcct      1140
     gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgact ctgaggttcc      1200
     gccctgctct ctgacacaat taagggataa aatctctgaa ggaatgacgg gaagacgatc      1260
     cctcgaatac tgatgagtgg ttccctttga cacacaccgg cagcagcctt gggcccgtga      1320
     cttttcctct caggccttgt tctctgcttc acactcaatg tgtgtggggg tctgagtcca      1380
     gcacttctga gtccctcagc ctccactcag gtcaggacca gaagtcgctg ttccctcttc      1440
     agggactaga attttccacg gaataggaga ttatcccagg tgcctgtgtc caggctggtg      1500
     tctgggttct gtgctccctt ccccatccca ggtgtcctgt ccattctcaa gatagccaca      1560
     tgtgtgctgg aggagtgtcc catgacagat gcaaaatgcc tgaatgttct gactctccct      1620
     gacagacgcc cccaagacgc atatgactca ccacgctgtc tctgaccatg aggccaccct      1680
     gaggtgctgg gccctgagct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1740
     ggaggaccag acccaggaca cggagctcgt ggagaccagg cctgcagggg atgggacctt      1800
     ccagaagtgg gcgtctgtgg tggtgccttc tggacaggag cagagataca cctgccatgt      1860
     gcagcatgag ggtctgccca agcccctcac cctgagatgg ggtaaggagg gagacggggg      1920
     tgtcatgtct tttagggaaa gcaggagcct ctctgacctt tagcagggtc agggcccctc      1980
     accttcccct cttttcccag agccgtcttc ccagcccacc atccccatcg tgggcatcat      2040
     tgctggcctg gttctctttg gagctgtgat cgctggagct gtggtcgctg ctgtgatgtg      2100
     gaggaggaag agctcaggtg gggaagggat gaagggtggg tctgagattt cttgtctcac      2160
     tgagggttcc aagacccagg tagaagtgtg ccctgcctcg ttactgggaa gcaccatcca      2220
     caattatgag cctacccagc ctgggccctg tgtgccagca cttactcttt tgtaaagcac      2280
     ctgttaaaat gaaggacaga tttatcacct tgattacggc ggtgatggga cctgatccca      2340
     gcagtcacaa gtcacagggg aaggtccctg aggaccttca ggagggcggt tggtccagga      2400
     cccacacctg ctttcttcat gtttcctgat cccgccctgg gtctgcagtc acacatttct      2460
     ggaaacttct ctgaggtcca agacttggag gttcctctag gaccttaagg ccctggctcc      2520
     tttctggtat ctcacaggac attttcttcc cacagataga aaaggaggga gctactctca      2580
     ggctgcaagt aagtatgaag gaggctgatg cctgaggtcc ttgggatatt gtgtttggga      2640
     gcccgtgggg gagctcaccc accccacaat tcctcctcta gccacatgtt ctgtgggatc      2700
     tgaccaggtt ctgtttttgt cctaccccag gcagtgacag tgcccagggc tctgatatgt      2760
     ctctcacagc ttgtaaaggt gagagcctgg agggcctgat gtgtgttggg tgttgggcgg      2820
     aacagtggac gcagctgtgc tatggggttt ctttgcattg gatgtattga gcatgcgatg      2880
     ggctgtttaa agtgtgactc ctcactgtga cagatacgaa tttgttcatg aatatttttt      2940
     tctatagtgt gagacagctg ccttgtgtgg gactgagagg caagatttgt tcctgccctt      3000
     ccctttgtga cttgaagaac cctgactttg t                                     3031
//


spacer
spacer