spacer

EBI Dbfetch

ID   FM945330; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   FM945330;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*4002new
DE   allele, exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (12-DEC-2008) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "New alleles found during routine HLA typing by sequencing. HLA B*4002new
RT   allele exon 1-4";
RL   Unpublished.
XX
DR   MD5; 7a92391980158267e8a5e9aa484f0fb1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B7VGE9"
FT                   /db_xref="IMGT/HLA:B*40:94"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7VGE9"
FT                   /protein_id="CAU70305.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4002new"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 188 A; 286 C; 298 G; 123 T; 300 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ctgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttccaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     caccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccacgagtcc       300
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag agcatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca taaccagtac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg           1195
//


spacer
spacer