spacer

EBI Dbfetch

ID   FM945329; SV 1; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   FM945329;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*2601new
DE   allele, exons 1-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1412
RA   Anholts J.D.H.;
RT   ;
RL   Submitted (12-DEC-2008) to the INSDC.
RL   Anholts J.D.H., Immunohematology and bloodtransfusion, Leiden University
RL   Medical Center, Albinusdreef 2, 2333 ZA, NETHERLANDS.
XX
RN   [2]
RA   Anholts J.D.H.;
RT   "New alleles found during routine HLA typing by sequencing. HLA A*2601new
RT   allele exon 1-5";
RL   Unpublished.
XX
DR   MD5; 5e272f89004eb342d2b9f3b3411b8146.
DR   Ensembl-Gn; ENSG00000206505; homo_sapiens.
DR   Ensembl-Tr; ENST00000383605; homo_sapiens.
DR   Ensembl-Tr; ENST00000383619; homo_sapiens.
DR   Ensembl-Tr; ENST00000549224; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B7VGE8"
FT                   /db_xref="IMGT/HLA:A*26:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7VGE8"
FT                   /protein_id="CAU70302.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..>1412
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601new"
FT                   /number=5
XX
SQ   Sequence 1412 BP; 192 A; 310 C; 348 G; 162 T; 400 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacggaat gtgaaggccc actcacagac tgaccgagcg aacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag aggatgtatg gctgcgacgt ggggccggac gggcgcttcc       600
     tccgcgggta ccagcaggac gcttacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggagacgg       720
     cccatgaggc ggagcagtgg agagcctacc tggagggccg gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cgcccccaag acgcatatga ctcaccatgc tgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggga ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagccg tcttcccagc ccaccatccc      1320
     catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcgctg gagctgtggt      1380
     cgctgctgtg atgtggagga ggaagagctc ag                                    1412
//


spacer
spacer