spacer

EBI Dbfetch

ID   FM886991; SV 1; linear; genomic DNA; STD; HUM; 1692 BP.
XX
AC   FM886991;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*44new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1692
RA   Witter K.;
RT   ;
RL   Submitted (09-DEC-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Tepnel SSO low resolution HLA-B typing revealed a new HLA-B allele,
RT   B*44new, in a rheumatoid arthritis study";
RL   Unpublished.
XX
DR   MD5; 6d6b777d5b634addb2b7b047eb36cb27.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1692
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,514..789,1364..>1639)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B7VFE3"
FT                   /db_xref="IMGT/HLA:B*44:83"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7VFE3"
FT                   /protein_id="CAT99520.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   intron          271..513
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   intron          790..1363
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   gap             1249..1332
FT                   /estimated_length=84
FT   exon            1364..1639
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   intron          1640..>1692
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
XX
SQ   Sequence 1692 BP; 324 A; 494 C; 512 G; 278 T; 84 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     gggggacggg gctgaccgcg gggccggggc cagggtctca catcatccag aggatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggta tgaccaggac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac agagcctacc       720
     tggagggcct gtgcgtggag tcgctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcggg taccaggggc agtggggagc cttccccatc tcctataggt cgccggggat       840
     ggcctcccac gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc ctcccttgaa       900
     tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct ctctaggaca       960
     attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagaa tactgatcag      1020
     gggtcccctt tgacccctgc agcagccttg ggaaccgtga cttttcctct caggccttgt      1080
     tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga gtcactttac      1140
     ctccactcag atcaggagca gaagtccctg ttccccgctc agagactcga actttccaat      1200
     gaataggaga ttatcccagg tgcctgcgtc caggctggtg tctgggttnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnagcgcctg aattttctga ctcttcccat cagacccccc aaagacacat      1380
     gtgacccacc accccatctc tgaccatgag gtcaccctga ggtgctgggc cctgggcttc      1440
     taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacacc      1500
     gagcttgtgg agaccagacc agcaggagat agaaccttcc agaagtgggc agctgtggtg      1560
     gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg gctgccgaag      1620
     cccctcaccc tgagatgggg taaggagggg gatgaggggt catatctctt ctcagggaaa      1680
     gcaggagccc tt                                                          1692
//


spacer
spacer