Dbfetch

ID   FM883600; SV 2; linear; genomic DNA; STD; HUM; 1044 BP.
XX
AC   FM883600;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   25-SEP-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*2402
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Witter K.;
RT   ;
RL   Submitted (05-DEC-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2009.01325.x.
RX   PUBMED; 19775376.
RA   Witter K., Kirchner E., Borelli C., Messer G., Albert T., Zahn R.,
RA   Kauke T.;
RT   "In a study for acne vulgaris, sequence-based HLA typing showed a novel
RT   DPB1 allele, DPB1*2402";
RL   Tissue Antigens 74(4):354-356(2009).
XX
RN   [3]
RP   1-1044
RA   Witter K.;
RT   ;
RL   Submitted (29-JUN-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
DR   MD5; 8248528027d52677ff21a4b10e3930a3.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1044
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..50
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /number=1
FT   CDS             join(<51..314,625..>906)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*121:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAT04585.2"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFARFYSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            51..314
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /number=2
FT   intron          315..627
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /number=2
FT   gap             335..434
FT                   /estimated_length=unknown
FT   exon            625..906
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /number=3
FT   intron          907..>1044
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*2402"
FT                   /number=3
XX
SQ   Sequence 1044 BP; 238 A; 251 C; 270 G; 185 T; 100 other;
     tccgctcatg agagtggcgg cctccgctca tgtccgcccc ctccccgcag agaattacct        60
     tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata       120
     catctacaac cgggaggagt tcgcgcgctt ctacagcgac gtgggggagt tccgggcggt       180
     gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca tcctggagga       240
     gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg ggcccatgac       300
     cctgcagcgc cgaggtgagt gagggctttg ggccnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnctgcat tccagacttg gcaacagagt gacactccat ctcaacaaaa       480
     agaaagaatg aaagaaagaa agagcgagat tatgtctcaa aaaaaaggaa ggaaggaagg       540
     aaggaaggaa ggaaggaagg aaggaaggaa ggaaagaagg acaatctcaa attctatttc       600
     attatttttc ttccacgctc ctagtccagc ctagggtgaa tgtttccccc tccaagaagg       660
     ggcccttgca gcaccacaac ctgcttgtct gccacgtgac ggatttctac ccaggcagca       720
     ttcaagtccg atggttcctg aatggacagg aggaaacagc tggggtcgtg tccaccaacc       780
     tgatccgtaa tggagactgg accttccaga tcctggtgat gctggaaatg accccccagc       840
     agggagatgt ctacacctgc caagtggagc acaccagcct ggatagtcct gtcaccgtgg       900
     agtggagtga gtctctgatg accctctaga ccccacctct gaagagcagg ggactctctg       960
     gctctggggt ccactcatct tatcttctgc atctataccc tggggccatg tccaaacccc      1020
     atctttcttc tataccagct cctg                                             1044
//