spacer

EBI Dbfetch

ID   FM882249; SV 1; linear; genomic DNA; STD; HUM; 1584 BP.
XX
AC   FM882249;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens, partial HLA-A gene for MHC class I antigen, HLA-A*0103
DE   allele, exon 1-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1584
RA   Dormoy A.;
RT   ;
RL   Submitted (03-DEC-2008) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B.;
RT   "This sequence confirm and complete the sequence of the allele HLA-A*0103
RT   already known.";
RL   Unpublished.
XX
DR   MD5; f35862a838d831c51bd1c2dd6a9ff5e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1584
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala C-9, fwd_seq:
FT                   ctgctactctcgggggcc, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..26,157..426,668..943,997..1272,1375..>1471)
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT   CDS             join(<1..26,157..426,668..943,997..1272,1375..>1471)
FT                   /codon_start=2
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:B7VF83"
FT                   /db_xref="IMGT/HLA:A*01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B7VF83"
FT                   /protein_id="CAT03457.1"
FT                   /translation="LALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFD
FT                   SDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
FT                   MMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQ
FT                   RRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLR
FT                   WELSSQPTIPIVGIIAGLVLLGAVITGAVVAAV"
FT   exon            1..26
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=1
FT   intron          27..156
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=1
FT   exon            157..426
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=2
FT   intron          427..667
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=2
FT   exon            668..943
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=3
FT   intron          944..996
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=3
FT   exon            997..1272
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=4
FT   intron          1273..1374
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=4
FT   exon            1375..1471
FT                   /gene="HLA-A"
FT                   /allele="A*0103"
FT                   /number=5
XX
SQ   Sequence 1584 BP; 289 A; 479 C; 557 G; 259 T; 0 other;
     cctggccctg acccagacct gggcgggtga gtgcggggtc gggagggaaa ccgcctctgc        60
     ggggagaagc aaggggccct cctggcgggg gcgcaggacc gggggagccg cgccgggagg       120
     agggtcgggc aggtctcagc cactgctcgc ccccaggctc ccactccatg aggtatttct       180
     tcacatccgt gtcccggccc ggccgcgggg agccccgctt catcgccgtg ggctacgtgg       240
     acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag ccagaagatg gagccgcggg       300
     cgccgtggat agagcaggag gggccggagt attgggacca ggagacacgg aatatgaagg       360
     cccactcaca gactgaccga gcgaacctgg ggaccctgcg cggctactac aaccagagcg       420
     aggacggtga gtgaccccgg cccggggcgc aggtcacgac ccctcatccc ccacggacgg       480
     gccaggtcgc ccacagtctc cgggtccgag atccaccccg aagccgcggg actccgagac       540
     ccttgtcccg ggagaggccc aggcgccttt acccggtttc attttcagtt taggccaaaa       600
     atccccccgg gttggtcggg gcggggcggg gctcggggga ctgggctgac cgcggggtcg       660
     gggccaggtt ctcacaccat ccagatgatg tatggctgcg acgtggggcc ggacgggcgc       720
     ttcctccgcg ggtaccggca ggacgcctac gacggcaagg attacatcgc cctgaacgag       780
     gacctgcgct cttggaccgc ggcggacatg gcagctcaga tcaccaagcg caagtgggag       840
     gcggtccatg cggcggagca gcggagagtc tacctggagg gccggtgcgt ggacgggctc       900
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgca cgggtaccag gggccacggg       960
     gcgcctctgc ctgaattttc tgactcttcc cgtcagaccc ccccaagaca catatgaccc      1020
     accaccccat ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg      1080
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg      1140
     tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt      1200
     ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca      1260
     ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa agcaggagcc      1320
     tctctggaga cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagctgt      1380
     cttcccagcc caccatcccc atcgtgggca tcattgctgg cctggttctc cttggagctg      1440
     tgatcactgg agctgtggtc gctgctgtga tgtggaggag gaagagctca ggtggagaag      1500
     gggtgaaggg tggggtctga gatttcttgt ctcactgagg gttccaagtc ccagctagaa      1560
     atgtgccctg tctcattact ggga                                             1584
//


spacer
spacer