Dbfetch

ID   FM882212; SV 1; linear; genomic DNA; STD; HUM; 984 BP.
XX
AC   FM882212;
XX
DT   14-DEC-2008 (Rel. 98, Created)
DT   14-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1701
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-984
RA   Witter K.;
RT   ;
RL   Submitted (03-DEC-2008) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Confirmation of several HLA-DPB1 alleles including exon 3";
RL   Unpublished.
XX
DR   MD5; 02b17d9e904d84552170767542da4ac5.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..984
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..40
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /number=1
FT   CDS             join(<41..304,553..>834)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*17:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAT03206.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /number=2
FT   intron          305..562
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /number=2
FT   gap             330..429
FT                   /estimated_length=unknown
FT   exon            553..834
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /number=3
FT   intron          835..>984
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1701"
FT                   /number=3
XX
SQ   Sequence 984 BP; 215 A; 232 C; 261 G; 176 T; 100 other;
     gagagtggcc gctccgctca tgtccgcccc ctccccgcag agaattacgt gcaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggacta ctggaacagc cagaaggaca tcctggagga ggagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttg ggccggcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnng aaagaaagaa agagcgagat tatgtctcaa aaaaaaggaa ggaaggaagg       480
     aaggaaggaa ggaaggaagg aaagaaggac aatctcaaat tctatttcat tatttttctt       540
     ccacgctcct agtccagcct agggtgaatg tttccccctc caagaagggg cccttgcagc       600
     accacaacct gcttgtctgc cacgtgacgg atttctaccc aggcagcatt caagtccgat       660
     ggttcctgaa tggacaggag gaaacagctg gggtcgtgtc caccaacctg atccgtaatg       720
     gagactggac cttccagatc ctggtgatgc tggaaatgac cccccagcag ggagatgtct       780
     acacctgcca agtggagcac accagcctgg atagtcctgt caccgtggag tggagtgagt       840
     ctctgatgac cctctagacc ccacctctga agagcagggg actctctggc tctggggtcc       900
     actcatctta tcttctgcat ctataccctg gggccatgtc caaaccccat ctttcttcta       960
     taccagctcc tgagcatagt tttg                                              984
//