spacer

EBI Dbfetch

ID   FM865869; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FM865869;
XX
DT   04-NOV-2009 (Rel. 102, Created)
DT   04-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*07 new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Schroeder M.L.;
RT   ;
RL   Submitted (03-NOV-2008) to the INSDC.
RL   Schroeder M.L., HLA Laboratory, CancerCare Manitoba, MS739C - 820 Sherbrook
RL   Street, Winnipeg/Manitoba/R3A 1R9, CANADA.
XX
RN   [2]
RA   Schroeder M.L.;
RT   "Four members of an Italian family with a novel HLA-Cw allele";
RL   Unpublished.
XX
DR   MD5; 9d3efb70570f9d0d8c33fd20fabd0273.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada"
FT                   /collected_by="Aggie Gentile"
FT                   /collection_date="08-Feb-2008"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..270,371..646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 new"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D0R0G1"
FT                   /db_xref="IMGT/HLA:C*07:65"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0R0G1"
FT                   /protein_id="CAR97798.1"
FT                   /translation="CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRG
FT                   EPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLG
FT                   PDGRLLRGYDQSAYDGKDYIALNEDLLSWTAADTAAQITQRKLEAARAAEQLRAYLEGT
FT                   CVEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT                   /note="intron 2"
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 105 A; 174 C; 195 G; 72 T; 100 other;
     tgctcccact ccatgaggta tttcgacacc gccgtgtccc ggcccggccg cggagagccc        60
     cgcttcatct cagtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       120
     gcgagtccga gaggggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg       180
     gaccgggaga cacagaacta caagcgccag gcacaggctg accgagtgag cctgcggaac       240
     ctgcgcggct actacaacca gagcgaggac nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gggtctcaca ccctccagag gatgtatggc tgcgacctgg ggcccgacgg       420
     gcgcctcctc cgcgggtatg accagtccgc ctacgacggc aaggattaca tcgccctgaa       480
     cgaggacctg ctctcctgga ccgccgcgga caccgcggct cagatcaccc agcgcaagtt       540
     ggaggcggcc cgtgcggcgg agcagctgag agcctacctg gagggcacgt gcgtggagtg       600
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgca                      646
//


spacer
spacer