Dbfetch

ID   FM865853; SV 1; linear; genomic DNA; STD; HUM; 1689 BP.
XX
AC   FM865853;
XX
DT   05-NOV-2008 (Rel. 97, Created)
DT   05-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*03new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1689
RA   Dormoy A.;
RT   ;
RL   Submitted (03-NOV-2008) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Weschler B.;
RT   "The Cw*03new allele is identical to the allele Cw*0303/0320N except a
RT   silent subsitution at nucleotide position 235 (T -> C) and a nucleotide
RT   substitution at position 419 leading to the change of the amino acid 116
RT   (Tyr (TAC) -> Ser (TCC))";
RL   Unpublished.
XX
DR   MD5; 7beec393a4fe396d1fbda5dc53f78efc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1689
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /PCR_primers="fwd_name: P5' Intron1 Cw(T24), fwd_seq:
FT                   tgcggggttgggagggaat, rev_name: P3' Intron 4C, rev_seq:
FT                   ctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<82..351,597..872,1339..>1614)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:B6VPZ5"
FT                   /db_xref="IMGT/HLA:C*03:43:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6VPZ5"
FT                   /protein_id="CAR97781.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHIIQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            82..351
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=2
FT   intron          352..596
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=2
FT   exon            597..872
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=3
FT   intron          873..1338
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=3
FT   exon            1339..1614
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=4
XX
SQ   Sequence 1689 BP; 330 A; 505 C; 572 G; 282 T; 0 other;
     gcccgcccgg cgagggcgca ggacccgggg agccgcgcag ggaggagggt cgggcgggtc        60
     tcagcccctc ctcgccccca ggctcccact ccatgaggta tttctacacc gctgtgtccc       120
     ggcccggccg cggggagccc cacttcatcg cagtgggcta cgtggacgac acgcagttcg       180
     tgcggttcga cagcgacgcc gcgagtccga gaggggagcc gcgggcgccg tgggtggagc       240
     aggaggggcc ggagtattgg gaccgggaga cacagaagta caagcgccag gcacagactg       300
     accgagtgag cctgcggaac ctgcgcggct actacaacca gagcgaggcc agtgagtgac       360
     cccggcccgg ggcgcaggtc acgacccctc ctcatccccc acggacggcc cgggtcgccc       420
     caagtctccc ggtctgagat ccaccccgag gctgcggaac ccgcccagac cctcgaccgg       480
     agagagcccc agtcaccttt acccggtttc attttcagtt taggccaaaa tccccgcggg       540
     ttggtcgggg cggggcgggg ctcgggggac ggggctgacc gcgggggcgg ggccagggtc       600
     tcacatcatc cagaggatgt atggctgcga cgtggggccc gacgggcgcc tcctccgcgg       660
     gtatgaccag tccgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       720
     ctggaccgcc gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       780
     ggcggagcag ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       840
     gaagaatggg aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg agccttcccc       900
     atctcctgta gatctcccgg gatggcctcc cacgaggagg ggaggaaaat gggatcagcg       960
     ctagaatatc gccctccctt gaatggagaa tgggatgagt tttcctgagt ttcctctgag      1020
     ggccccctct gctctctagg acaattaagg gatgaagtcc ttgaggaaat ggaggggaag      1080
     acagtcccta gaatactgat tgagtccttc ggcctccact caggtcagga ccagaagtcg      1140
     ctgttcctcc ctcagagact agaactttcc aatgaatagg agattatccc aggtgcctgt      1200
     gtccaggctg gcgtctgggt tctgtgcccc cttccccacc ccaggtgtcc tgtccgttct      1260
     caggatggtc acatgggcgc tgttggagtg tcgcaagaga gatacaaagt gtctgaattt      1320
     tctgactctt cccgtcagaa cacccaaaga cacacgtgac ccaccatccc gtctctgacc      1380
     atgaggccac cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct      1440
     ggcagtggga tggggaggac caaactcagg acactgagct tgtggagacc aggccagcag      1500
     gagatggaac cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat      1560
     acacgtgcca tgtgcagcac gaggggctgc cggagcccct caccctgaga tggggtaagg      1620
     agggggatga ggggtgatgt gtcttctcag ggaaagcaga agtcctggag cccttcagcc      1680
     aggtcaggg                                                              1689
//